DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and cDIP

DIOPT Version :10

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster


Alignment Length:436 Identity:104/436 - (23%)
Similarity:166/436 - (38%) Gaps:105/436 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 ELTFLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLRGNQISELHQ 147
            :|..|.||.||:..:|.:||.....|:.:.||.||:|                        :|..
  Fly   142 KLVILLLSDNHIEVLPTKTFRGAGNLEFIFLNRNKLG------------------------KLQA 182

  Fly   148 GTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVIFQAMPSLAELFLGM 212
            |.|..|||::.|:|.|||:..|....|.||..||.:.|..|.|||: :..:|...|.|..:.:..
  Fly   183 GAFDNLLKLQYLDLTENRLEALAADVFAGLKSLRHVGLAGNQLTTI-ESDLFAHNPDLLSVAMQN 246

  Fly   213 NTLQSIQADAFQ-----------DLKG-------LTRLELKGASLRNISHDSFLGLQELRILDLS 259
            |.|:.:...||:           ||..       |..:.....:.||.|.|.......:..:|||
  Fly   247 NRLREVGEYAFRSRGRHHQMQYVDLSNNPELVVLLLNINATNLTARNCSLDRVNLYGSVTNVDLS 311

  Fly   260 DNRLDRI--PSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALRLKRVMTGAFSD 322
            |||:..:  |:     ...||.|.|..|  .::...:...:.:|:.|:|              :|
  Fly   312 DNRVRELYFPA-----SEALEHLVLRNN--SLVQLASLSRVPRLRHLDV--------------AD 355

  Fly   323 NGN------------LEYLNLSSNKMLLEVQEGALSGLSQLKHVVLKANALTSLAEGLFP-WKDL 374
            |.|            ||.|.| .|...:|:...||.|:..|:.:.:..|.||.:....|| ...|
  Fly   356 NPNLGQLPDGWRTPHLEMLVL-RNTGQMELPLEALQGMQNLQKLDISGNNLTEIDPSAFPTLTQL 419

  Fly   375 QTLDLSENPLSCDCRVMWLHNL---LVAKNASQDDVSELLCEFP-ERLRGESLRHLNPAMMGCTH 435
            ....:..|..:|    ..|.|:   |:..|.....|.....:|| |...|          :.|.:
  Fly   420 THFYIHGNNWNC----FSLRNIMDVLIRANGIAYTVDNYDPDFPGEYFHG----------IACMY 470

  Fly   436 ADPRKQAL-------IGALLVGSAATITALALVLYRCRHKIRETIK 474
            ..|.|:.:       |.|.:..|..|.::....:.:.|.:::..::
  Fly   471 RLPEKEGVDSSSSSEISASVESSPITSSSDPSEVDKLRDELKAVVQ 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380
LRR 82..406 CDD:443914 91/358 (25%)
leucine-rich repeat 84..107 CDD:275380 9/22 (41%)
leucine-rich repeat 108..131 CDD:275380 6/22 (27%)
leucine-rich repeat 132..155 CDD:275380 4/22 (18%)
leucine-rich repeat 156..179 CDD:275380 9/22 (41%)
leucine-rich repeat 180..204 CDD:275380 8/23 (35%)
leucine-rich repeat 205..228 CDD:275380 7/33 (21%)
leucine-rich repeat 229..252 CDD:275380 5/22 (23%)
leucine-rich repeat 253..276 CDD:275380 7/24 (29%)
leucine-rich repeat 277..300 CDD:275380 5/22 (23%)
leucine-rich repeat 301..322 CDD:275380 3/20 (15%)
leucine-rich repeat 326..350 CDD:275380 9/23 (39%)
leucine-rich repeat 351..373 CDD:275380 6/22 (27%)
LRRCT 382..434 CDD:214507 11/55 (20%)
cDIPNP_650951.1 LRR 107..>410 CDD:443914 82/314 (26%)
leucine-rich repeat 118..142 CDD:275380 104/436 (24%)
leucine-rich repeat 143..166 CDD:275380 9/22 (41%)
leucine-rich repeat 167..190 CDD:275380 10/46 (22%)
leucine-rich repeat 191..214 CDD:275380 9/22 (41%)
leucine-rich repeat 215..238 CDD:275380 8/23 (35%)
leucine-rich repeat 239..265 CDD:275380 5/25 (20%)
leucine-rich repeat 266..325 CDD:275380 14/63 (22%)
leucine-rich repeat 326..347 CDD:275380 5/22 (23%)
leucine-rich repeat 348..394 CDD:275380 15/60 (25%)
leucine-rich repeat 395..418 CDD:275380 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.