DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and CG18249

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001163549.1 Gene:CG18249 / 40964 FlyBaseID:FBgn0037553 Length:559 Species:Drosophila melanogaster


Alignment Length:462 Identity:116/462 - (25%)
Similarity:180/462 - (38%) Gaps:126/462 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SIGVEPAAG----LANCPPG-CQCDDNTLVV--------------QCGEGQLDVLPIALNPSIQR 63
            ::.|..|:|    .|:||.. |...|..:..              .|....:..|.:.|.|.::.
  Fly    19 ALAVYDASGRFNLSASCPDSFCSLSDRPVAYSATPALQLRELHLRNCSRQSITWLVLQLTPGLRT 83

  Fly    64 LVIKSNKIKTID-SSIQFYAELTFLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFI 127
            |||::.....|. .|::....||.|.:....|..:..:.|....:|:.:.|:.|.|..:....|.
  Fly    84 LVIRNCATYHISKESLRPVENLTSLQMQGTSLGVLRDQIFNAVPRLEILQLSQNFIHTVHVAAFQ 148

  Fly   128 GLSAVTVLNLRGNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNAL-T 191
            |||.:.:|.|:||.|:|:...|..||:::..|:|..|.:..|....|....:|:.|.|:.|.| .
  Fly   149 GLSKLRLLGLQGNAIAEILSSTLDPLMELVHLDLSRNELTTLPQNIFAKNKKLQTLLLNGNPLRI 213

  Fly   192 TVPDPVIFQAMPSLAELFLG------MNTLQSIQADAFQDLKGLTRLELKGASLRNI-------- 242
            .:||  :..::|:|..|.||      :.||         :|..:..|.|:|:||.::        
  Fly   214 LMPD--VLGSLPNLRLLDLGHAAELEVMTL---------NLTNVQNLVLEGSSLSSLVINGGFIK 267

  Fly   243 -----------------------SHDSFL----------GLQELRILDLSDNRLDRIPSVG---- 270
                                   .|.:.|          |:..|:.||||.||::.:|..|    
  Fly   268 LQAGNNELNHLQVGNKSSVIEMDLHGNLLNGNDTAALLRGMWNLQRLDLSKNRIEALPQHGSGLD 332

  Fly   271 ------LSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALRLKRVMTGAFSDNGNLEYL 329
                  |..|..|:.|:|..|              ||.||.....:...|           |.||
  Fly   333 ASGTQELLILPSLKFLNLANN--------------QLVRLPPESPILSSR-----------LSYL 372

  Fly   330 NLSSNKML-LEVQEGALSGLSQLKHVVLKANALTS-----LAEGLFPWKDLQTLDLSENPLSCDC 388
            :||.|.|| |:|  ..|..||.||.:.::.|.|.:     |.|   ...||..|.|.:||.|...
  Fly   373 DLSHNLMLTLDV--AILRSLSVLKGLYVEGNRLNTINYQKLHE---EHPDLSELGLHDNPWSSGL 432

  Fly   389 -RVMWLH 394
             |.|:|:
  Fly   433 YRKMFLY 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 5/18 (28%)
LRR_8 83..142 CDD:290566 17/58 (29%)
leucine-rich repeat 84..107 CDD:275380 5/22 (23%)
leucine-rich repeat 108..131 CDD:275380 7/22 (32%)
LRR_RI 129..421 CDD:238064 88/331 (27%)
LRR_8 132..190 CDD:290566 18/57 (32%)
leucine-rich repeat 132..155 CDD:275380 9/22 (41%)
leucine-rich repeat 156..179 CDD:275380 5/22 (23%)
leucine-rich repeat 180..204 CDD:275380 7/24 (29%)
LRR_8 203..263 CDD:290566 22/106 (21%)
leucine-rich repeat 205..228 CDD:275380 7/28 (25%)
leucine-rich repeat 229..252 CDD:275380 8/63 (13%)
LRR_8 252..308 CDD:290566 19/65 (29%)
leucine-rich repeat 253..276 CDD:275380 11/32 (34%)
leucine-rich repeat 277..300 CDD:275380 4/22 (18%)
leucine-rich repeat 301..322 CDD:275380 4/20 (20%)
LRR_8 325..384 CDD:290566 24/64 (38%)
leucine-rich repeat 326..350 CDD:275380 12/24 (50%)
leucine-rich repeat 351..373 CDD:275380 6/26 (23%)
CG18249NP_001163549.1 leucine-rich repeat 57..80 CDD:275380 3/22 (14%)
LRR_8 104..163 CDD:290566 17/58 (29%)
leucine-rich repeat 105..128 CDD:275380 5/22 (23%)
LRR_RI 107..438 CDD:238064 96/371 (26%)
leucine-rich repeat 129..152 CDD:275380 7/22 (32%)
leucine-rich repeat 153..176 CDD:275380 9/22 (41%)
LRR_8 176..232 CDD:290566 16/57 (28%)
leucine-rich repeat 177..200 CDD:275380 5/22 (23%)
leucine-rich repeat 201..224 CDD:275380 7/24 (29%)
leucine-rich repeat 225..258 CDD:275380 12/41 (29%)
leucine-rich repeat 259..310 CDD:275380 3/50 (6%)
leucine-rich repeat 311..344 CDD:275380 11/32 (34%)
LRR_8 343..403 CDD:290566 25/86 (29%)
leucine-rich repeat 345..368 CDD:275380 8/36 (22%)
leucine-rich repeat 369..390 CDD:275380 11/22 (50%)
leucine-rich repeat 393..417 CDD:275380 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453588
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.