Sequence 1: | NP_001261796.1 | Gene: | trn / 39491 | FlyBaseID: | FBgn0010452 | Length: | 751 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_649770.1 | Gene: | CG7800 / 40963 | FlyBaseID: | FBgn0037552 | Length: | 533 | Species: | Drosophila melanogaster |
Alignment Length: | 354 | Identity: | 96/354 - (27%) |
---|---|---|---|
Similarity: | 144/354 - (40%) | Gaps: | 89/354 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 100 RTFAYQK--KLQEVHLNH---------------------------NKIGQISNKTFIGLSAVTVL 135
Fly 136 NLRGNQISELHQGTFT--PLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVI 198
Fly 199 FQAMPSLAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLS---- 259
Fly 260 --------------DN----RLDRIPSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEV 306
Fly 307 NG----ALRLKRVMTGAFSDNGNLEYLNLSSNKMLLEVQEGA-----LSGLSQLKHVVLKANALT 362
Fly 363 SL-AEGLFPWKDLQTLDLSENPLSCDCRV 390 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
trn | NP_001261796.1 | leucine-rich repeat | 62..80 | CDD:275380 | |
LRR_8 | 83..142 | CDD:290566 | 15/70 (21%) | ||
leucine-rich repeat | 84..107 | CDD:275380 | 4/8 (50%) | ||
leucine-rich repeat | 108..131 | CDD:275380 | 6/49 (12%) | ||
LRR_RI | 129..421 | CDD:238064 | 86/296 (29%) | ||
LRR_8 | 132..190 | CDD:290566 | 24/59 (41%) | ||
leucine-rich repeat | 132..155 | CDD:275380 | 8/24 (33%) | ||
leucine-rich repeat | 156..179 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 180..204 | CDD:275380 | 8/23 (35%) | ||
LRR_8 | 203..263 | CDD:290566 | 21/81 (26%) | ||
leucine-rich repeat | 205..228 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 229..252 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 252..308 | CDD:290566 | 17/77 (22%) | ||
leucine-rich repeat | 253..276 | CDD:275380 | 12/44 (27%) | ||
leucine-rich repeat | 277..300 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 301..322 | CDD:275380 | 4/24 (17%) | ||
LRR_8 | 325..384 | CDD:290566 | 22/64 (34%) | ||
leucine-rich repeat | 326..350 | CDD:275380 | 8/28 (29%) | ||
leucine-rich repeat | 351..373 | CDD:275380 | 9/22 (41%) | ||
CG7800 | NP_649770.1 | leucine-rich repeat | 46..64 | CDD:275380 | 3/17 (18%) |
leucine-rich repeat | 65..85 | CDD:275380 | 1/19 (5%) | ||
LRR_8 | 87..147 | CDD:290566 | 24/61 (39%) | ||
leucine-rich repeat | 89..112 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 113..136 | CDD:275380 | 11/24 (46%) | ||
LRR_RI | <131..334 | CDD:238064 | 58/218 (27%) | ||
leucine-rich repeat | 137..160 | CDD:275380 | 8/23 (35%) | ||
LRR_8 | 140..195 | CDD:290566 | 17/55 (31%) | ||
leucine-rich repeat | 161..184 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 185..208 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 209..246 | CDD:275380 | 10/36 (28%) | ||
leucine-rich repeat | 247..267 | CDD:275380 | 5/30 (17%) | ||
leucine-rich repeat | 268..292 | CDD:275380 | 4/27 (15%) | ||
leucine-rich repeat | 293..322 | CDD:275380 | 8/28 (29%) | ||
leucine-rich repeat | 395..406 | CDD:275378 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45453587 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |