DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and CG7800

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster


Alignment Length:354 Identity:96/354 - (27%)
Similarity:144/354 - (40%) Gaps:89/354 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 RTFAYQK--KLQEVHLNH---------------------------NKIGQISNKTFIGLSAVTVL 135
            |||:.:|  ||.|.|::.                           |.:.|        |..:|.|
  Fly    36 RTFSDKKATKLTEFHMDSCEKKVLKLMPNLRTLELENCDSPDFTMNDLNQ--------LPYLTSL 92

  Fly   136 NLRGNQISELHQGTFT--PLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVI 198
            .||...:..||...|:  |.:||  |.||.|.|..|..:.|.||:||.:|.|..|.:..:|..| 
  Fly    93 QLRRGNLLGLHDEHFSKWPNMKI--LMLGGNNITRLSNECFKGLAQLWLLSLPGNGIQGLPWDV- 154

  Fly   199 FQAMPSLAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLS---- 259
            ||.:|.|..|.|..|.::::..:.|..:..|..|.|.|..|..|:..|...|..||:||:|    
  Fly   155 FQNLPELLHLDLSGNRIETLHENIFTGVPKLEMLLLNGNPLTWIAPTSLKSLSNLRLLDMSNCGP 219

  Fly   260 --------------DN----RLDRIPSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEV 306
                          ||    |||.:.||        .:|...:|.   |:|........:..|::
  Fly   220 LPDLSLPGAHTLILDNSGVQRLDILGSV--------HKLQARKNH---ITEIKLPDKSSVIELDL 273

  Fly   307 NG----ALRLKRVMTGAFSDNGNLEYLNLSSNKMLLEVQEGA-----LSGLSQLKHVVLKANALT 362
            :.    |..:.:::||.:    .|:.|:||.|.:.:....|:     |..|..|.::.|.||.||
  Fly   274 HSNLLTATDIPKLLTGMW----RLQRLDLSENIIGIYAAAGSDNTSELFILPNLMYMNLSANRLT 334

  Fly   363 SL-AEGLFPWKDLQTLDLSENPLSCDCRV 390
            .| .:...||:.|..||.|.|.:....:|
  Fly   335 RLHFDSPIPWERLTHLDASYNRIYAPAKV 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380
LRR_8 83..142 CDD:290566 15/70 (21%)
leucine-rich repeat 84..107 CDD:275380 4/8 (50%)
leucine-rich repeat 108..131 CDD:275380 6/49 (12%)
LRR_RI 129..421 CDD:238064 86/296 (29%)
LRR_8 132..190 CDD:290566 24/59 (41%)
leucine-rich repeat 132..155 CDD:275380 8/24 (33%)
leucine-rich repeat 156..179 CDD:275380 10/22 (45%)
leucine-rich repeat 180..204 CDD:275380 8/23 (35%)
LRR_8 203..263 CDD:290566 21/81 (26%)
leucine-rich repeat 205..228 CDD:275380 5/22 (23%)
leucine-rich repeat 229..252 CDD:275380 8/22 (36%)
LRR_8 252..308 CDD:290566 17/77 (22%)
leucine-rich repeat 253..276 CDD:275380 12/44 (27%)
leucine-rich repeat 277..300 CDD:275380 4/22 (18%)
leucine-rich repeat 301..322 CDD:275380 4/24 (17%)
LRR_8 325..384 CDD:290566 22/64 (34%)
leucine-rich repeat 326..350 CDD:275380 8/28 (29%)
leucine-rich repeat 351..373 CDD:275380 9/22 (41%)
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 3/17 (18%)
leucine-rich repeat 65..85 CDD:275380 1/19 (5%)
LRR_8 87..147 CDD:290566 24/61 (39%)
leucine-rich repeat 89..112 CDD:275380 7/22 (32%)
leucine-rich repeat 113..136 CDD:275380 11/24 (46%)
LRR_RI <131..334 CDD:238064 58/218 (27%)
leucine-rich repeat 137..160 CDD:275380 8/23 (35%)
LRR_8 140..195 CDD:290566 17/55 (31%)
leucine-rich repeat 161..184 CDD:275380 5/22 (23%)
leucine-rich repeat 185..208 CDD:275380 8/22 (36%)
leucine-rich repeat 209..246 CDD:275380 10/36 (28%)
leucine-rich repeat 247..267 CDD:275380 5/30 (17%)
leucine-rich repeat 268..292 CDD:275380 4/27 (15%)
leucine-rich repeat 293..322 CDD:275380 8/28 (29%)
leucine-rich repeat 395..406 CDD:275378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.