| Sequence 1: | NP_001261796.1 | Gene: | trn / 39491 | FlyBaseID: | FBgn0010452 | Length: | 751 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_005573.2 | Gene: | CD180 / 4064 | HGNCID: | 6726 | Length: | 661 | Species: | Homo sapiens |
| Alignment Length: | 624 | Identity: | 136/624 - (21%) |
|---|---|---|---|
| Similarity: | 203/624 - (32%) | Gaps: | 228/624 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 13 WCILASIGVEPAAGLANCPPGCQCDDNTLVVQCGEGQLDVLPIALNPSIQRLVIKSNKIKTI-DS 76
Fly 77 SIQFYAELTFLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLRGNQ 141
Fly 142 ISELHQGTFTP---LLKIEELNLGENRIGYLD-PKAFDGLSQLRILYLDDNALTTVP-------- 194
Fly 195 ----------------------DPVIFQAM-----PSLAELFLGM--NTLQSIQADAFQD----- 225
Fly 226 -----LKGLTRLELKGASLR-----NISHDSFLGLQELRILDLSDNRLDRIPS------------ 268
Fly 269 -----------------------------------VG-LSKLVRLEQLSLGQNDFEV-------- 289
Fly 290 ------------------ISEGAFMGLKQLK-------RLEVNGA------LRLKRV--MTGAFS 321
Fly 322 DNGN---------LEYLNLSSNKM--------------------------LLEVQEGALSGLSQL 351
Fly 352 KHVVLKANALTS-----------------------LAEGLFPWKDLQ-TLDLSENPLSCDCR--- 389
Fly 390 -VMW----LHNLLVAKNASQDDVSELLCEFPERLRGESL 423 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| trn | NP_001261796.1 | leucine-rich repeat | 62..80 | CDD:275380 | 4/18 (22%) |
| LRR_8 | 83..142 | CDD:290566 | 15/58 (26%) | ||
| leucine-rich repeat | 84..107 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 108..131 | CDD:275380 | 4/22 (18%) | ||
| LRR_RI | 129..421 | CDD:238064 | 108/503 (21%) | ||
| LRR_8 | 132..190 | CDD:290566 | 20/61 (33%) | ||
| leucine-rich repeat | 132..155 | CDD:275380 | 8/25 (32%) | ||
| leucine-rich repeat | 156..179 | CDD:275380 | 9/23 (39%) | ||
| leucine-rich repeat | 180..204 | CDD:275380 | 8/58 (14%) | ||
| LRR_8 | 203..263 | CDD:290566 | 21/76 (28%) | ||
| leucine-rich repeat | 205..228 | CDD:275380 | 9/34 (26%) | ||
| leucine-rich repeat | 229..252 | CDD:275380 | 5/27 (19%) | ||
| LRR_8 | 252..308 | CDD:290566 | 24/136 (18%) | ||
| leucine-rich repeat | 253..276 | CDD:275380 | 12/70 (17%) | ||
| leucine-rich repeat | 277..300 | CDD:275380 | 8/48 (17%) | ||
| leucine-rich repeat | 301..322 | CDD:275380 | 8/35 (23%) | ||
| LRR_8 | 325..384 | CDD:290566 | 23/117 (20%) | ||
| leucine-rich repeat | 326..350 | CDD:275380 | 9/49 (18%) | ||
| leucine-rich repeat | 351..373 | CDD:275380 | 8/44 (18%) | ||
| CD180 | NP_005573.2 | leucine-rich repeat | 38..57 | CDD:275380 | 4/18 (22%) |
| LRR 1 | 54..75 | 4/20 (20%) | |||
| leucine-rich repeat | 58..78 | CDD:275380 | 4/19 (21%) | ||
| LRR 2 | 78..99 | 9/20 (45%) | |||
| leucine-rich repeat | 79..102 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 102..161 | CDD:290566 | 17/61 (28%) | ||
| LRR 3 | 102..123 | 3/20 (15%) | |||
| leucine-rich repeat | 103..126 | CDD:275380 | 4/22 (18%) | ||
| LRR 4 | 126..147 | 7/23 (30%) | |||
| leucine-rich repeat | 127..150 | CDD:275380 | 8/25 (32%) | ||
| LRR 5 | 150..171 | 8/20 (40%) | |||
| leucine-rich repeat | 151..174 | CDD:275380 | 9/23 (39%) | ||
| LRR 6 | 174..195 | 4/20 (20%) | |||
| leucine-rich repeat | 175..195 | CDD:275380 | 4/19 (21%) | ||
| leucine-rich repeat | 196..234 | CDD:275380 | 4/37 (11%) | ||
| LRR 7 | 201..221 | 0/19 (0%) | |||
| leucine-rich repeat | 235..275 | CDD:275380 | 12/39 (31%) | ||
| LRR 8 | 275..296 | 4/20 (20%) | |||
| leucine-rich repeat | 276..299 | CDD:275380 | 4/22 (18%) | ||
| LRR 9 | 299..320 | 7/20 (35%) | |||
| leucine-rich repeat | 300..322 | CDD:275380 | 7/21 (33%) | ||
| LRR 10 | 322..343 | 0/20 (0%) | |||
| LRR_8 | 323..382 | CDD:290566 | 9/58 (16%) | ||
| leucine-rich repeat | 323..371 | CDD:275380 | 5/47 (11%) | ||
| LRR_RI | 327..541 | CDD:238064 | 39/213 (18%) | ||
| LRR 11 | 346..366 | 2/19 (11%) | |||
| LRR_8 | 371..432 | CDD:290566 | 10/60 (17%) | ||
| LRR 12 | 371..391 | 6/19 (32%) | |||
| leucine-rich repeat | 372..397 | CDD:275380 | 6/24 (25%) | ||
| LRR 13 | 397..418 | 2/20 (10%) | |||
| leucine-rich repeat | 398..421 | CDD:275380 | 2/22 (9%) | ||
| LRR_8 | 420..481 | CDD:290566 | 16/60 (27%) | ||
| LRR 14 | 421..442 | 5/20 (25%) | |||
| leucine-rich repeat | 422..446 | CDD:275380 | 5/23 (22%) | ||
| LRR 15 | 446..466 | 5/19 (26%) | |||
| leucine-rich repeat | 447..470 | CDD:275380 | 5/22 (23%) | ||
| LRR 16 | 470..493 | 5/22 (23%) | |||
| leucine-rich repeat | 471..497 | CDD:275380 | 5/25 (20%) | ||
| LRR_8 | 497..555 | CDD:290566 | 10/57 (18%) | ||
| LRR 17 | 497..518 | 3/20 (15%) | |||
| leucine-rich repeat | 498..521 | CDD:275380 | 4/22 (18%) | ||
| LRR 18 | 521..544 | 6/22 (27%) | |||
| leucine-rich repeat | 522..543 | CDD:275380 | 6/20 (30%) | ||
| LRR 19 | 546..564 | 1/17 (6%) | |||
| TPKR_C2 | 577..626 | CDD:301599 | 16/50 (32%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24373 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||