DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and Toll-6

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001246765.1 Gene:Toll-6 / 39663 FlyBaseID:FBgn0036494 Length:1514 Species:Drosophila melanogaster


Alignment Length:394 Identity:120/394 - (30%)
Similarity:184/394 - (46%) Gaps:37/394 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EPAAGLANCPPGCQCDDNTLVVQCGEGQLDVLPIALNPSIQR---LVIKSNKIKTI-DSSIQFYA 82
            |.|...::....|..|...|.|  ......|||.....:::|   |.:.:|.|..| |.::....
  Fly   263 ESAKKSSSSSTSCSLDLEYLDV--SHNDFVVLPANGFGTLRRLRVLSVNNNGISMIADKALSGLK 325

  Fly    83 ELTFLDLSSNHLMTIPQRTFAYQKK-LQEVHLNHNKIGQISNKTFIGLSAVTVLNLRGNQISE-- 144
            .|..|:||||.::.:|...||.|.| :|||:|.:|.|..::.:.|..|..:..|:|..|||:.  
  Fly   326 NLQILNLSSNKIVALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQALDLSMNQITSTW 390

  Fly   145 LHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVIFQAMPSLAELF 209
            :.:.||..|:::..|||..|::..|:|:.|..|..|:||.|..|.|..:.... |..|.:|..|.
  Fly   391 IDKNTFVGLIRLVLLNLSHNKLTKLEPEIFSDLYTLQILNLRHNQLENIAADT-FAPMNNLHTLL 454

  Fly   210 LGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLSDNRLDRIPSVGLSKL 274
            |..|.|:.:.|.|...|..|:.|.|...:|..:..|:|.....|:.|:|:.|:|..:| :.|..:
  Fly   455 LSHNKLKYLDAYALNGLYVLSLLSLDNNALIGVHPDAFRNCSALQDLNLNGNQLKTVP-LALRNM 518

  Fly   275 VRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALRLKRVMTGAFSDNGNLEYLNLSSNKMLLE 339
            ..|..:.||:|...|:.:.||.||..|..|.:.|.. |:.:....|.|..||:.|||:.|::.: 
  Fly   519 RHLRTVDLGENMITVMEDSAFKGLGNLYGLRLIGNY-LENITMHTFRDLPNLQILNLARNRIAV- 581

  Fly   340 VQEGALSGLSQLKHVVLKANALTSLAEGLFP------W-----------------KDLQTLDLSE 381
            |:.||....|.::.|.|..|.|..: .|||.      |                 ..||.|||.:
  Fly   582 VEPGAFEMTSSIQAVRLDGNELNDI-NGLFSNMPSLLWLNISDNRLESFDYGHVPSTLQWLDLHK 645

  Fly   382 NPLS 385
            |.||
  Fly   646 NRLS 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 6/21 (29%)
LRR_8 83..142 CDD:290566 22/59 (37%)
leucine-rich repeat 84..107 CDD:275380 10/22 (45%)
leucine-rich repeat 108..131 CDD:275380 8/22 (36%)
LRR_RI 129..421 CDD:238064 87/282 (31%)
LRR_8 132..190 CDD:290566 21/59 (36%)
leucine-rich repeat 132..155 CDD:275380 8/24 (33%)
leucine-rich repeat 156..179 CDD:275380 8/22 (36%)
leucine-rich repeat 180..204 CDD:275380 8/23 (35%)
LRR_8 203..263 CDD:290566 18/59 (31%)
leucine-rich repeat 205..228 CDD:275380 8/22 (36%)
leucine-rich repeat 229..252 CDD:275380 6/22 (27%)
LRR_8 252..308 CDD:290566 18/55 (33%)
leucine-rich repeat 253..276 CDD:275380 7/22 (32%)
leucine-rich repeat 277..300 CDD:275380 9/22 (41%)
leucine-rich repeat 301..322 CDD:275380 5/20 (25%)
LRR_8 325..384 CDD:290566 24/81 (30%)
leucine-rich repeat 326..350 CDD:275380 8/23 (35%)
leucine-rich repeat 351..373 CDD:275380 8/44 (18%)
Toll-6NP_001246765.1 leucine-rich repeat 148..171 CDD:275380
LRR_8 171..236 CDD:290566
leucine-rich repeat 172..201 CDD:275380
leucine-rich repeat 202..278 CDD:275380 3/14 (21%)
leucine-rich repeat 229..249 CDD:275380
LRR_RI 278..468 CDD:238064 61/192 (32%)
leucine-rich repeat 279..302 CDD:275380 5/24 (21%)
LRR_8 301..386 CDD:290566 28/84 (33%)
leucine-rich repeat 303..326 CDD:275380 5/22 (23%)
leucine-rich repeat 327..350 CDD:275380 10/22 (45%)
LRR 350..729 CDD:227223 95/305 (31%)
leucine-rich repeat 352..375 CDD:275380 8/22 (36%)
leucine-rich repeat 376..401 CDD:275380 8/24 (33%)
LRR_RI <401..626 CDD:238064 70/229 (31%)
leucine-rich repeat 402..425 CDD:275380 8/22 (36%)
leucine-rich repeat 426..449 CDD:275380 8/23 (35%)
leucine-rich repeat 450..473 CDD:275380 8/22 (36%)
leucine-rich repeat 474..497 CDD:275380 6/22 (27%)
leucine-rich repeat 498..518 CDD:275380 7/20 (35%)
leucine-rich repeat 521..544 CDD:275380 9/22 (41%)
leucine-rich repeat 545..566 CDD:275380 5/21 (24%)
leucine-rich repeat 569..592 CDD:275380 8/23 (35%)
leucine-rich repeat 593..615 CDD:275380 7/22 (32%)
leucine-rich repeat 616..637 CDD:275380 1/20 (5%)
leucine-rich repeat 638..662 CDD:275380 8/12 (67%)
leucine-rich repeat 663..684 CDD:275380
leucine-rich repeat 685..708 CDD:275380
leucine-rich repeat 709..728 CDD:275380
LRR_8 883..943 CDD:290566
leucine-rich repeat 885..908 CDD:275380
leucine-rich repeat 909..932 CDD:275380
LRR_8 932..990 CDD:290566
leucine-rich repeat 933..956 CDD:275380
TIR 1114..1247 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453591
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.