| Sequence 1: | NP_001261796.1 | Gene: | trn / 39491 | FlyBaseID: | FBgn0010452 | Length: | 751 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001163434.1 | Gene: | CG42709 / 39453 | FlyBaseID: | FBgn0261674 | Length: | 458 | Species: | Drosophila melanogaster |
| Alignment Length: | 246 | Identity: | 61/246 - (24%) |
|---|---|---|---|
| Similarity: | 87/246 - (35%) | Gaps: | 76/246 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 21 VEPAAGLANCPPGCQCDDNTLVVQCGEGQLDVLPIALNPSIQRLVIKSNKIKTIDSSIQFYAELT 85
Fly 86 FLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLRGNQISELHQGTF 150
Fly 151 TPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALT--------TVPDPV---------- 197
Fly 198 -----IFQAMPSLAELFLGMNTL-QSIQADAFQDLKGLTRLELKGASLRNI 242 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| trn | NP_001261796.1 | leucine-rich repeat | 62..80 | CDD:275380 | 2/17 (12%) |
| LRR_8 | 83..142 | CDD:290566 | 15/58 (26%) | ||
| leucine-rich repeat | 84..107 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 108..131 | CDD:275380 | 9/22 (41%) | ||
| LRR_RI | 129..421 | CDD:238064 | 33/138 (24%) | ||
| LRR_8 | 132..190 | CDD:290566 | 13/57 (23%) | ||
| leucine-rich repeat | 132..155 | CDD:275380 | 2/22 (9%) | ||
| leucine-rich repeat | 156..179 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 180..204 | CDD:275380 | 11/46 (24%) | ||
| LRR_8 | 203..263 | CDD:290566 | 13/41 (32%) | ||
| leucine-rich repeat | 205..228 | CDD:275380 | 9/23 (39%) | ||
| leucine-rich repeat | 229..252 | CDD:275380 | 4/14 (29%) | ||
| LRR_8 | 252..308 | CDD:290566 | |||
| leucine-rich repeat | 253..276 | CDD:275380 | |||
| leucine-rich repeat | 277..300 | CDD:275380 | |||
| leucine-rich repeat | 301..322 | CDD:275380 | |||
| LRR_8 | 325..384 | CDD:290566 | |||
| leucine-rich repeat | 326..350 | CDD:275380 | |||
| leucine-rich repeat | 351..373 | CDD:275380 | |||
| CG42709 | NP_001163434.1 | LRR_8 | 126..182 | CDD:290566 | 20/79 (25%) |
| leucine-rich repeat | 128..147 | CDD:275380 | 6/18 (33%) | ||
| leucine-rich repeat | 148..171 | CDD:275380 | 11/46 (24%) | ||
| LRR_RI | <150..225 | CDD:238064 | 26/98 (27%) | ||
| LRR_8 | 171..254 | CDD:290566 | 22/82 (27%) | ||
| leucine-rich repeat | 172..195 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 220..243 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 244..268 | CDD:275380 | 9/23 (39%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45453532 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||