DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and ELFN1

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001122108.1 Gene:ELFN1 / 392617 HGNCID:33154 Length:828 Species:Homo sapiens


Alignment Length:835 Identity:161/835 - (19%)
Similarity:272/835 - (32%) Gaps:240/835 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IWCILASIGVEPAAGLANCPPGCQCDDNTLV--VQCGEGQ--LDVLPIALNPSIQRLVIKSNKIK 72
            :|..:|:..:..|.|||.........|...|  ..|.:.|  .:.:|..:|.:|..|.:..|:|:
Human     9 LWVCVAAATLLHAGGLARADCWLIEGDKGFVWLAICSQNQPPYEAIPQQINSTIVDLRLNENRIR 73

  Fly    73 TID-SSIQFYAELTFLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLN 136
            ::. :|:..:..||:|:|:.|.:..|....|:.|..||.:.|.:|::..::.....||..:..|.
Human    74 SVQYASLSRFGNLTYLNLTKNEIGYIEDGAFSGQFNLQVLQLGYNRLRNLTEGMLRGLGKLEYLY 138

  Fly   137 LRGNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVIFQA 201
            |:.|.|..:...:|.....|..::|..|||..|:...|.||::|.:..|..|......:.:.|  
Human   139 LQANLIEVVMASSFWECPNIVNIDLSMNRIQQLNSGTFAGLAKLSVCELYSNPFYCSCELLGF-- 201

  Fly   202 MPSLAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLSDNRLDRI 266
            :..||.......|...:|.::.....|   ..|.|...|  .|.|.  |.:|:.:...|:....:
Human   202 LRWLAAFTNATQTYDRMQCESPPVYSG---YYLLGQGRR--GHRSI--LSKLQSVCTEDSYAAEV 259

  Fly   267 -----PSVGLSKLVRL-------EQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALRLKRVMTGA 319
                 |:.|.|:..|.       |...:...|.|..|......|..|..|......|        
Human   260 VGPPRPASGRSQPGRSPPPPPPPEPSDMPCADDECFSGDGTTPLVALPTLATQAEAR-------- 316

  Fly   320 FSDNGNLEYLNLSSNKMLLEVQEGALSGLSQLKHVVLKANALTSLAEGLFPWKDLQTLD-LSENP 383
                            .|::|::             |..|:.|...:...|:..:.||: .:.:.
Human   317 ----------------PLIKVKQ-------------LTQNSATITVQLPSPFHRMYTLEHFNNSK 352

  Fly   384 LSCDCRV------MWLHNLLVAKNASQDDVSELLCEFPERLRGESLRHLNPAMMGCTHADPRKQA 442
            .|...|:      :.|.||....|.:...||          ....|||.:..:..|.   ||..:
Human   353 ASTVSRLTKAQEEIRLTNLFTLTNYTYCVVS----------TSAGLRHNHTCLTICL---PRLPS 404

  Fly   443 LIGALLVGSAAT---------ITALALVL---YRCRHKIRETIKGGLWGNSALGRKEREYQKTFC 495
            ..|.:...|.||         :..:.|||   |.|..:.|              |:|.:::|.  
Human   405 PPGPVPSPSTATHYIMTILGCLFGMVLVLGAVYYCLRRRR--------------RQEEKHKKA-- 453

  Fly   496 DEDYMSRHQHHPCSLGIHSTFPNTYTAPHHPGATHHYGMCPMPVNDLGAIDPQQKFQQLVVPTAT 560
                        .|.....:...|.....:.......|:.|:....|  :.|:...:...:|.|.
Human   454 ------------ASAAAAGSLKKTIIELKYGPELEAPGLAPLSQGPL--LGPEAVTRIPYLPAAG 504

  Fly   561 MISEKKL----NNNKALVSQGAI--------------------DDSASFVLHMKSATMGRDVHQQ 601
            .:.:.||    :..||  |:|:.                    .||.|.|..:  :|:.::|.:.
Human   505 EVEQYKLVESADTPKA--SKGSYMEVRTGDPPERRDCELGRPGPDSQSSVAEI--STIAKEVDKV 565

  Fly   602 NPQLNHYTKPQFLSATATVG--DSCYSYADVPMV----------------------------HGA 636
            |..:|:........:|:..|  ....|.|:.|:|                            |..
Human   566 NQIINNCIDALKSESTSFQGVKSGPVSVAEPPLVLLSEPLAAKHGFLAPGYKDAFGHSLQRHHSV 630

  Fly   637 PLGGP-----------NQPQ------------------------------LRLTQEHFKQRELYD 660
            ...||           ..|:                              |.:|......|.  :
Human   631 EAAGPPRASTSSSGSVRSPRAFRAEAVGVHKAAAAEAKYIEKGSPAADAILTVTPAAAVLRA--E 693

  Fly   661 QEMGSEILDHNYIYSNTHYSMPLEQLGRSKTPTPPPMPPALPLRNGLCATTGRRS 715
            .|.|.:..:|.:.|..:|   |.|       |..||.||..|...||    ||::
Human   694 AEKGRQYGEHRHSYPGSH---PAE-------PPAPPGPPPPPPHEGL----GRKA 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 4/18 (22%)
LRR_8 83..142 CDD:290566 17/58 (29%)
leucine-rich repeat 84..107 CDD:275380 8/22 (36%)
leucine-rich repeat 108..131 CDD:275380 6/22 (27%)
LRR_RI 129..421 CDD:238064 60/310 (19%)
LRR_8 132..190 CDD:290566 17/57 (30%)
leucine-rich repeat 132..155 CDD:275380 5/22 (23%)
leucine-rich repeat 156..179 CDD:275380 9/22 (41%)
leucine-rich repeat 180..204 CDD:275380 4/23 (17%)
LRR_8 203..263 CDD:290566 13/59 (22%)
leucine-rich repeat 205..228 CDD:275380 4/22 (18%)
leucine-rich repeat 229..252 CDD:275380 6/22 (27%)
LRR_8 252..308 CDD:290566 13/67 (19%)
leucine-rich repeat 253..276 CDD:275380 5/27 (19%)
leucine-rich repeat 277..300 CDD:275380 5/29 (17%)
leucine-rich repeat 301..322 CDD:275380 3/20 (15%)
LRR_8 325..384 CDD:290566 8/59 (14%)
leucine-rich repeat 326..350 CDD:275380 2/23 (9%)
leucine-rich repeat 351..373 CDD:275380 4/21 (19%)
ELFN1NP_001122108.1 LRR 1 61..82 5/20 (25%)
leucine-rich repeat 65..85 CDD:275378 4/19 (21%)
LRR_8 85..144 CDD:404697 17/58 (29%)
LRR 2 85..106 7/20 (35%)
leucine-rich repeat 86..109 CDD:275378 8/22 (36%)
LRR 3 109..130 4/20 (20%)
leucine-rich repeat 110..133 CDD:275378 6/22 (27%)
LRR 4 133..154 5/20 (25%)
leucine-rich repeat 134..157 CDD:275378 5/22 (23%)
LRR 5 157..178 7/20 (35%)
leucine-rich repeat 158..171 CDD:275378 5/12 (42%)
PCC 162..>256 CDD:188093 25/102 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..291 5/31 (16%)
LRR 6 318..342 6/36 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 517..552 7/36 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 624..649 3/24 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 696..732 14/49 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.