DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and CG6749

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster


Alignment Length:411 Identity:111/411 - (27%)
Similarity:178/411 - (43%) Gaps:79/411 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GEGQLDVL--PIALNPSIQRLVIKSNKIKTIDSSI------QFYAE----------------LTF 86
            |.|.:|:.  ..|...::||:....|:::.:|...      ..||.                |..
  Fly   113 GCGLVDIRGNHFAPESALQRIDFSHNQMELLDRDFFGNLRKLIYANFSHNALKQCDLPHMPLLNR 177

  Fly    87 LDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLRGNQISELHQGTFT 151
            |:|..|.|:   ..||....:|||:.||.|::.|:....|.||..:..|.|.||::|.:...||.
  Fly   178 LELGHNRLV---NATFGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQ 239

  Fly   152 PLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVIFQAMPSLAELFLGMNTLQ 216
            ||.::.:|||.:|.:..|.|..| |..|..:|:|.                    :|.|..|.::
  Fly   240 PLAQLRKLNLSQNALDALRPNVF-GAVQNFVLHLQ--------------------QLDLSGNRIR 283

  Fly   217 SIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLSDNRLDRIPSVGLSKLVRLEQLS 281
            .:..:.|:.|..|..|::...|:.::|...|:||..||.|.|..|.:..|.....:.|:.|:.|.
  Fly   284 LLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLD 348

  Fly   282 LGQNDFEVISEGAFMG--LKQLKRLEVNGALRLKRVMTGAFSDNGNLEYLNLSSNK--------- 335
            |..|:.|.:.|..|.|  |.:::||.:||. |:|.:...|||....||||.|..|:         
  Fly   349 LSYNNLEFLEEQIFGGNTLPRMRRLNLNGN-RMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMF 412

  Fly   336 --------------MLLEVQEGALSGLSQLKHVVLKANALTSLAEGLFPWKDLQTLDLSENPLSC 386
                          :|.|:....|..||.::.:::..|.||.||:....:.:|:.:.:..||..|
  Fly   413 APMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKVNVSFPNLKRVAIEGNPWQC 477

  Fly   387 DCRVMWLHNLLVAKNASQDDV 407
            .|.|...|.|     |::|.|
  Fly   478 PCFVKLQHWL-----ATRDVV 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 4/23 (17%)
LRR_8 83..142 CDD:290566 21/74 (28%)
leucine-rich repeat 84..107 CDD:275380 7/22 (32%)
leucine-rich repeat 108..131 CDD:275380 10/22 (45%)
LRR_RI 129..421 CDD:238064 85/304 (28%)
LRR_8 132..190 CDD:290566 20/57 (35%)
leucine-rich repeat 132..155 CDD:275380 9/22 (41%)
leucine-rich repeat 156..179 CDD:275380 8/22 (36%)
leucine-rich repeat 180..204 CDD:275380 2/23 (9%)
LRR_8 203..263 CDD:290566 17/59 (29%)
leucine-rich repeat 205..228 CDD:275380 5/22 (23%)
leucine-rich repeat 229..252 CDD:275380 7/22 (32%)
LRR_8 252..308 CDD:290566 18/57 (32%)
leucine-rich repeat 253..276 CDD:275380 7/22 (32%)
leucine-rich repeat 277..300 CDD:275380 9/24 (38%)
leucine-rich repeat 301..322 CDD:275380 8/20 (40%)
LRR_8 325..384 CDD:290566 18/81 (22%)
leucine-rich repeat 326..350 CDD:275380 10/46 (22%)
leucine-rich repeat 351..373 CDD:275380 5/21 (24%)
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 40/145 (28%)
LRR_8 104..164 CDD:290566 10/50 (20%)
leucine-rich repeat 106..129 CDD:275380 4/15 (27%)
leucine-rich repeat 130..153 CDD:275380 4/22 (18%)
leucine-rich repeat 154..195 CDD:275380 9/43 (21%)
LRR_RI 194..455 CDD:238064 81/282 (29%)
LRR_8 194..254 CDD:290566 23/59 (39%)
leucine-rich repeat 196..219 CDD:275380 10/22 (45%)
leucine-rich repeat 220..243 CDD:275380 9/22 (41%)
leucine-rich repeat 244..267 CDD:275380 8/23 (35%)
LRR_8 271..330 CDD:290566 18/78 (23%)
leucine-rich repeat 272..295 CDD:275380 6/42 (14%)
leucine-rich repeat 296..319 CDD:275380 7/22 (32%)
LRR_8 319..380 CDD:290566 20/61 (33%)
leucine-rich repeat 320..343 CDD:275380 7/22 (32%)
leucine-rich repeat 344..369 CDD:275380 9/24 (38%)
LRR_8 368..428 CDD:290566 15/60 (25%)
leucine-rich repeat 370..393 CDD:275380 9/23 (39%)
leucine-rich repeat 394..417 CDD:275380 6/22 (27%)
leucine-rich repeat 418..441 CDD:275380 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472909
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.