DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and LRRC26

DIOPT Version :10

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001013675.1 Gene:LRRC26 / 389816 HGNCID:31409 Length:334 Species:Homo sapiens


Alignment Length:169 Identity:32/169 - (18%)
Similarity:56/169 - (33%) Gaps:75/169 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 RLVTLRRKLAEQG-----VDAENCPPGQHSGLICPTCEGGNSGEKSLSLFIAPDGSSATWNCFRG 167
            |...|||.||.:|     ||..:....|.     ||..|.::|||:                   
Human    17 RTEELRRALASEGRAVYVVDDASVLGAQD-----PTVYGDSAGEKA------------------- 57

  Fly   168 KCGLKGGVRADGGLASADPIEKVERKIT------------VEGIELE----------PLC--DEI 208
               |:..:||           .|||:::            ::|...|          |||  ..:
Human    58 ---LRAALRA-----------AVERRLSRQDVVILDSVNYIKGFRYELYCLARAARTPLCLLYCV 108

  Fly   209 QDYFAARAISRKTLERNRVMQKRIGDEIVIAFTYWQRGE 247
            :..:.:|.:...:...||        ::.::.::..|.|
Human   109 RPNWPSRELREASASENR--------DLAVSVSWRPRAE 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380
LRR 82..406 CDD:443914 32/169 (19%)
leucine-rich repeat 84..107 CDD:275380
leucine-rich repeat 108..131 CDD:275380 9/27 (33%)
leucine-rich repeat 132..155 CDD:275380 6/22 (27%)
leucine-rich repeat 156..179 CDD:275380 3/22 (14%)
leucine-rich repeat 180..204 CDD:275380 5/45 (11%)
leucine-rich repeat 205..228 CDD:275380 4/24 (17%)
leucine-rich repeat 229..252 CDD:275380 2/19 (11%)
leucine-rich repeat 253..276 CDD:275380
leucine-rich repeat 277..300 CDD:275380
leucine-rich repeat 301..322 CDD:275380
leucine-rich repeat 326..350 CDD:275380
leucine-rich repeat 351..373 CDD:275380
LRRCT 382..434 CDD:214507
LRRC26NP_001013675.1 LRR 1 72..93 2/20 (10%)
LRR <79..>201 CDD:443914 10/69 (14%)
LRR 2 96..117 4/20 (20%)
leucine-rich repeat 97..120 CDD:275380 4/22 (18%)
LRR 3 120..141 4/28 (14%)
leucine-rich repeat 121..144 CDD:275380 4/27 (15%)
LRR 4 144..167
leucine-rich repeat 145..168 CDD:275380
LRR 5 168..190
leucine-rich repeat 169..192 CDD:275380
PCC 174..>242 CDD:188093
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..334
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.