DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and Toll-7

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_523797.1 Gene:Toll-7 / 37272 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster


Alignment Length:574 Identity:148/574 - (25%)
Similarity:215/574 - (37%) Gaps:184/574 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LANCPPGCQCDDNTLVV-------------------QCGEG------QLDVLPIALNP------- 59
            |...|.|..|....|.|                   .||.|      :|.||..:.|.       
  Fly   201 LRQLPSGFLCPVGNLQVLNLTRNRIRTAEQMGFADMNCGAGSGSAGSELQVLDASHNELRSISES 265

  Fly    60 -------SIQRLVIKSNKIKTID-SSIQFYAELTFLDLSSNHLMTIPQRTFAYQKKLQEVHLNHN 116
                   .:|.|.:..|.:..:. .::...|.|..::||:|||.|:|:..||..|:|:|:||..|
  Fly   266 WGISRLRRLQHLNLAYNNLSELSGEALAGLASLRIVNLSNNHLETLPEGLFAGSKELREIHLQQN 330

  Fly   117 KI--------------------------GQISNKTFIGL----------SAVT------------ 133
            ::                          ..:.|.||.||          :|:|            
  Fly   331 ELYELPKGLFHRLEQLLVVDLSGNQLTSNHVDNTTFAGLIRLIVLNLAHNALTRIDYRTFKELYF 395

  Fly   134 --VLNLRGNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDP 196
              :||||.|.|..:....|.||..:..|||.|||:..||.|.|:||..|..|.|::| |.:|.:|
  Fly   396 LQILNLRNNSIGHIEDNAFLPLYNLHTLNLAENRLHTLDDKLFNGLYVLSKLTLNNN-LISVVEP 459

  Fly   197 VIFQAMPSLAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLSDN 261
            .:|:....|.||.|..|.|..:.. |.|||..|..|:|....:|...:.||..|.:|..|.|.||
  Fly   460 AVFKNCSDLKELDLSSNQLNEVPR-ALQDLAMLRTLDLGENQIRTFDNQSFKNLHQLTGLRLIDN 523

  Fly   262 RLDRIPSVGL-SKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALRLKR----VMTGAFS 321
            ::..| :||: ..|.||..|:|.:|..:.|..|:|.     |..|:. |:||.|    .:.|.|:
  Fly   524 QIGNI-TVGMFQDLPRLSVLNLAKNRIQSIERGSFD-----KNFELE-AIRLDRNFLADINGVFA 581

  Fly   322 DNGNLEYLNLS------------------------------------------------------ 332
            ...:|.:||||                                                      
  Fly   582 TLVSLLWLNLSENHLVWFDYAFIPSNLKWLDIHGNYIEALGNYYKLQEEIRVKTLDASHNRITEI 646

  Fly   333 --------------SNKMLLEVQEGALSGLSQLKHVVLKANALTSL-------AEGLFPWKDLQT 376
                          :|.::..||..|....:.|..|.|.||.|:.|       |..:.| |.|..
  Fly   647 GPMSIPNTIELLFINNNLIGNVQPNAFVDKANLARVDLYANQLSKLQLQQLRVAPVVAP-KPLPE 710

  Fly   377 LDLSENPLSCDCRVMWL---HNLLVAKNASQDDVSELLCEFPERLRGESLRHLN 427
            ..|..||..|||.:.||   :||...::....|::.:.|..| ..||.::|.|:
  Fly   711 FYLGGNPFECDCTMDWLQRINNLTTRQHPRVMDMANIECVMP-HARGAAVRPLS 763

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 3/18 (17%)
LRR_8 83..142 CDD:290566 28/108 (26%)
leucine-rich repeat 84..107 CDD:275380 10/22 (45%)
leucine-rich repeat 108..131 CDD:275380 10/58 (17%)
LRR_RI 129..421 CDD:238064 108/398 (27%)
LRR_8 132..190 CDD:290566 26/71 (37%)
leucine-rich repeat 132..155 CDD:275380 10/36 (28%)
leucine-rich repeat 156..179 CDD:275380 12/22 (55%)
leucine-rich repeat 180..204 CDD:275380 8/23 (35%)
LRR_8 203..263 CDD:290566 22/59 (37%)
leucine-rich repeat 205..228 CDD:275380 10/22 (45%)
leucine-rich repeat 229..252 CDD:275380 7/22 (32%)
LRR_8 252..308 CDD:290566 19/56 (34%)
leucine-rich repeat 253..276 CDD:275380 9/23 (39%)
leucine-rich repeat 277..300 CDD:275380 7/22 (32%)
leucine-rich repeat 301..322 CDD:275380 8/24 (33%)
LRR_8 325..384 CDD:290566 22/133 (17%)
leucine-rich repeat 326..350 CDD:275380 9/91 (10%)
leucine-rich repeat 351..373 CDD:275380 9/28 (32%)
Toll-7NP_523797.1 LRR_8 135..201 CDD:290566 148/574 (26%)
leucine-rich repeat 136..159 CDD:275380
leucine-rich repeat 160..190 CDD:275380
LRR_8 189..259 CDD:290566 13/57 (23%)
leucine-rich repeat 191..214 CDD:275380 4/12 (33%)
leucine-rich repeat 215..248 CDD:275380 5/32 (16%)
LRR_RI 247..501 CDD:238064 73/255 (29%)
LRR_8 247..308 CDD:290566 12/60 (20%)
leucine-rich repeat 249..273 CDD:275380 4/23 (17%)
leucine-rich repeat 274..297 CDD:275380 3/22 (14%)
LRR_8 297..356 CDD:290566 16/58 (28%)
leucine-rich repeat 298..321 CDD:275380 10/22 (45%)
leucine-rich repeat 322..345 CDD:275380 5/22 (23%)
LRR_8 345..406 CDD:290566 12/60 (20%)
leucine-rich repeat 346..371 CDD:275380 5/24 (21%)
leucine-rich repeat 372..395 CDD:275380 2/22 (9%)
leucine-rich repeat 396..419 CDD:275380 9/22 (41%)
LRR_8 419..478 CDD:290566 25/59 (42%)
leucine-rich repeat 420..443 CDD:275380 12/22 (55%)
leucine-rich repeat 444..467 CDD:275380 8/23 (35%)
LRR_RI 466..622 CDD:238064 47/163 (29%)
leucine-rich repeat 468..488 CDD:275380 8/20 (40%)
LRR_8 491..549 CDD:290566 21/58 (36%)
leucine-rich repeat 491..514 CDD:275380 7/22 (32%)
leucine-rich repeat 515..536 CDD:275380 8/21 (38%)
leucine-rich repeat 539..562 CDD:275380 8/27 (30%)
leucine-rich repeat 563..585 CDD:275380 6/22 (27%)
leucine-rich repeat 586..626 CDD:275380 5/39 (13%)
leucine-rich repeat 627..653 CDD:275380 0/25 (0%)
LRRCT 716..772 CDD:214507 16/49 (33%)
LRRNT 796..830 CDD:214470
leucine-rich repeat 812..829 CDD:275380
leucine-rich repeat 833..854 CDD:275380
LRR_8 853..913 CDD:290566
leucine-rich repeat 855..878 CDD:275380
LRR_4 878..918 CDD:289563
leucine-rich repeat 879..902 CDD:275380
leucine-rich repeat 903..926 CDD:275380
leucine-rich repeat 927..953 CDD:275380
TIR 1098..1235 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453535
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.