DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and Lrg1

DIOPT Version :10

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:XP_038939952.1 Gene:Lrg1 / 367455 RGDID:1359464 Length:342 Species:Rattus norvegicus


Alignment Length:321 Identity:103/321 - (32%)
Similarity:151/321 - (47%) Gaps:56/321 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LSAVTV-LNLRGNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTT 192
            |.|.|| |::..:.:::|..........::||:|..||:..|.|.....:.:||:|.|..|||.:
  Rat    59 LPADTVHLSVEFSSLTQLPAAALQGCPGLQELHLSSNRLQELSPGLLAPVPRLRVLDLTRNALRS 123

  Fly   193 VPDPVIFQAMPSLAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILD 257
            :| |.:|::..:|..|.|..|.||...|...|                        ||..|..||
  Rat   124 LP-PGLFRSSAALNTLVLRENQLQEASARWLQ------------------------GLDALGYLD 163

  Fly   258 LSDNRLDRIPSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALRLKRVMTGAFSD 322
            |::|||..:|:..|:.|..|..|.||.|..|.:.||...|.::|:||.:.|. ||:|:..|..:.
  Rat   164 LAENRLRSLPARLLANLGALHTLDLGHNLLESLPEGFLRGPRRLQRLHLEGN-RLQRLEAGLLAP 227

  Fly   323 NGNLEYLNLSSNKMLLEVQEGALSGLSQLKHVVLKANALTSLAEGLF-----PWKDLQT-LDLSE 381
            ...|..|.|:.|: |..|...:..||.||..:.|..|:|:|...||:     |.:|:|. .|:|.
  Rat   228 QPFLGVLFLNDNQ-LTAVAADSFRGLKQLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDVSH 291

  Fly   382 NPLSCD------CRVMWL----HNLLVAKNASQDDVSELLCEFPERLRGESLRHLNPAMMG 432
            ||..||      ||  ||    |.:.     ||:|.   ||..||.:||:.|  |:.|.:|
  Rat   292 NPWVCDKDLVDLCR--WLAANRHKMF-----SQNDT---LCAGPEAVRGQRL--LDVAELG 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380
LRR 82..406 CDD:443914 92/293 (31%)
leucine-rich repeat 84..107 CDD:275380
leucine-rich repeat 108..131 CDD:275380 1/1 (100%)
leucine-rich repeat 132..155 CDD:275380 4/23 (17%)
leucine-rich repeat 156..179 CDD:275380 7/22 (32%)
leucine-rich repeat 180..204 CDD:275380 10/23 (43%)
leucine-rich repeat 205..228 CDD:275380 8/22 (36%)
leucine-rich repeat 229..252 CDD:275380 2/22 (9%)
leucine-rich repeat 253..276 CDD:275380 10/22 (45%)
leucine-rich repeat 277..300 CDD:275380 9/22 (41%)
leucine-rich repeat 301..322 CDD:275380 8/20 (40%)
leucine-rich repeat 326..350 CDD:275380 8/23 (35%)
leucine-rich repeat 351..373 CDD:275380 8/26 (31%)
LRRCT 382..434 CDD:214507 22/61 (36%)
Lrg1XP_038939952.1 leucine-rich repeat 65..86 CDD:275380 2/20 (10%)
LRR <80..>267 CDD:443914 67/213 (31%)
leucine-rich repeat 87..110 CDD:275380 7/22 (32%)
leucine-rich repeat 111..134 CDD:275380 10/23 (43%)
leucine-rich repeat 135..158 CDD:275380 10/46 (22%)
leucine-rich repeat 159..182 CDD:275380 10/22 (45%)
leucine-rich repeat 183..206 CDD:275380 9/22 (41%)
leucine-rich repeat 207..230 CDD:275380 8/23 (35%)
leucine-rich repeat 231..254 CDD:275380 8/23 (35%)
leucine-rich repeat 255..278 CDD:275380 7/22 (32%)
PCC 259..>339 CDD:188093 32/91 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.