DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and RTN4RL2

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_848665.1 Gene:RTN4RL2 / 349667 HGNCID:23053 Length:420 Species:Homo sapiens


Alignment Length:550 Identity:138/550 - (25%)
Similarity:194/550 - (35%) Gaps:184/550 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CILASIGVEPAAGLANCPPGCQCDDNTLVVQCGEGQLDVLPIALNPSIQRLVIKSNKIKTIDSSI 78
            |:|..:...|.|. .:||..|.|..:...|.|.......:|::|.||.|||.:::|.|:|:... 
Human    16 CLLLMLLALPLAA-PSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPG- 78

  Fly    79 QFYAELTFLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLRGNQIS 143
            .|.:.|..|.|.||:|.||                                              
Human    79 TFGSNLLTLWLFSNNLSTI---------------------------------------------- 97

  Fly   144 ELHQGTFTPLLKIEELNLGENR-IGYLDPKAFDGLSQLRILYLDDNALTTVPDPVIFQAMPSLAE 207
              :.|||..|..:|||:||:|| :..|:|..|.||.:|:.|:|....|:::|.. ||:.:.||..
Human    98 --YPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGN-IFRGLVSLQY 159

  Fly   208 LFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLSDNRLDRIPSVGLS 272
            |:|..|:|..:|.|.|.||..|:.|.|.|..||                                
Human   160 LYLQENSLLHLQDDLFADLANLSHLFLHGNRLR-------------------------------- 192

  Fly   273 KLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALRLKRVMTGAFSDNGNLEYLNLSSNKML 337
                            :::|..|.||..|.||.::|. ||:.|...||                 
Human   193 ----------------LLTEHVFRGLGSLDRLLLHGN-RLQGVHRAAF----------------- 223

  Fly   338 LEVQEGALSGLSQLKHVVLKANALTSL-AEGLFPWKDLQTLDLSENPLSCDCRV----MWLHNLL 397
                    .|||:|..:.|..|:|.|| .|.|.....|:.|.|:.||.:||||.    .|.....
Human   224 --------RGLSRLTILYLFNNSLASLPGEALADLPSLEFLRLNANPWACDCRARPLWAWFQRAR 280

  Fly   398 VAKNASQDDVSELLCEFPERLRGESLRHLNPA-MMGCTHADPRKQA-----------LIGALLVG 450
            |:.       |::.|..|...:|..||.|..| ...|..|.|.:..           |.|   |.
Human   281 VSS-------SDVTCATPPERQGRDLRALREADFQACPPAAPTRPGSRARGNSSSNHLYG---VA 335

  Fly   451 SAATITALALVLYRCRHKIRETIKGGLWGNSALGRK------EREYQKTFCDEDYMSRH------ 503
            .|....|....|||           .|....:.||:      |.:|...:..||.....      
Human   336 EAGAPPADPSTLYR-----------DLPAEDSRGRQGGDAPTEDDYWGGYGGEDQRGEQMCPGAA 389

  Fly   504 -QHHPCSLG--IHSTFPN-----TYTAPHH 525
             |..|.|.|  :.:..|:     ....|||
Human   390 CQAPPDSRGPALSAGLPSPLLCLLLLVPHH 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 6/17 (35%)
LRR_8 83..142 CDD:290566 8/58 (14%)
leucine-rich repeat 84..107 CDD:275380 8/22 (36%)
leucine-rich repeat 108..131 CDD:275380 0/22 (0%)
LRR_RI 129..421 CDD:238064 78/297 (26%)
LRR_8 132..190 CDD:290566 19/58 (33%)
leucine-rich repeat 132..155 CDD:275380 4/22 (18%)
leucine-rich repeat 156..179 CDD:275380 12/23 (52%)
leucine-rich repeat 180..204 CDD:275380 7/23 (30%)
LRR_8 203..263 CDD:290566 17/59 (29%)
leucine-rich repeat 205..228 CDD:275380 10/22 (45%)
leucine-rich repeat 229..252 CDD:275380 6/22 (27%)
LRR_8 252..308 CDD:290566 7/55 (13%)
leucine-rich repeat 253..276 CDD:275380 0/22 (0%)
leucine-rich repeat 277..300 CDD:275380 4/22 (18%)
leucine-rich repeat 301..322 CDD:275380 9/20 (45%)
LRR_8 325..384 CDD:290566 15/59 (25%)
leucine-rich repeat 326..350 CDD:275380 2/23 (9%)
leucine-rich repeat 351..373 CDD:275380 8/22 (36%)
RTN4RL2NP_848665.1 LRR_8 60..117 CDD:290566 26/105 (25%)
leucine-rich repeat 62..83 CDD:275380 7/21 (33%)
leucine-rich repeat 84..107 CDD:275380 12/70 (17%)
LRR_RI 103..>261 CDD:238064 64/232 (28%)
LRR_8 108..167 CDD:290566 24/59 (41%)
leucine-rich repeat 108..132 CDD:275380 12/23 (52%)
leucine-rich repeat 133..156 CDD:275380 7/23 (30%)
LRR_8 156..215 CDD:290566 25/107 (23%)
leucine-rich repeat 157..180 CDD:275380 10/22 (45%)
leucine-rich repeat 181..204 CDD:275380 10/70 (14%)
LRR_8 204..262 CDD:290566 23/83 (28%)
leucine-rich repeat 205..228 CDD:275380 11/48 (23%)
leucine-rich repeat 229..252 CDD:275380 8/22 (36%)
TPKR_C2 261..311 CDD:301599 16/56 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11786
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.