DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and IGFALS

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001139478.1 Gene:IGFALS / 3483 HGNCID:5468 Length:643 Species:Homo sapiens


Alignment Length:715 Identity:178/715 - (24%)
Similarity:266/715 - (37%) Gaps:220/715 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GVEP-----AAGLANCPPGCQC----DDNTLVVQCGEGQLDVLPIALNPSIQRLVIKSNKIKTI- 74
            |.:|     |.|.| ||..|.|    |.:.|.|.|....|..||..:....|.|.:..|.:.:: 
Human    65 GADPGTPGEAEGPA-CPAACVCSYDDDADELSVFCSSRNLTRLPDGVPGGTQALWLDGNNLSSVP 128

  Fly    75 DSSIQFYAELTFLDLSS------------------------NHLMTIPQRTFAYQKKLQEVHLNH 115
            .::.|..:.|.||:|..                        |.|.::...|||:...|..:.|::
Human   129 PAAFQNLSSLGFLNLQGGQLGSLEPQALLGLENLCHLHLERNQLRSLALGTFAHTPALASLGLSN 193

  Fly   116 NKIGQISNKTFIGLSAVTVLNLRGNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQL 180
            |::.::.:..|.||.::..|||..|.::.|....|..|..:.||.|..||:.||.|..|.||::|
Human   194 NRLSRLEDGLFEGLGSLWDLNLGWNSLAVLPDAAFRGLGSLRELVLAGNRLAYLQPALFSGLAEL 258

  Fly   181 RILYLDDNALTTVPDPVIFQAMPSLAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHD 245
            |.|.|..|||..:...|..| :|.|.:|:|..|.:.::...||..||.|..|:|....:..:..|
Human   259 RELDLSRNALRAIKANVFVQ-LPRLQKLYLDRNLIAAVAPGAFLGLKALRWLDLSHNRVAGLLED 322

  Fly   246 SFLGLQELRILDLSDNRLDRIPSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGAL 310
            :|.||..||:|.||.|.:..:.......|..||:|.||.|....::|.:|.||.||:.|.::.. 
Human   323 TFPGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEGLGQLEVLTLDHN- 386

  Fly   311 RLKRVMTGAFSDNGNLEYLNLSSN-----------------------KMLLEVQEGALSGLSQLK 352
            :|:.|..|||....|:..:|||.|                       ..|..::....:|||.|:
Human   387 QLQEVKAGAFLGLTNVAVMNLSGNCLRNLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFTGLSGLR 451

  Fly   353 HVVLKANALTSLAE-GLFPWKDLQTLDLSENPLSCDCRVMW-----LHNLLVAKNASQDDVSELL 411
            .:.||.|.|..:.| .|:...:|..|||:.|.|:.....::     |..||:::|.        |
Human   452 RLFLKDNGLVGIEEQSLWGLAELLELDLTSNQLTHLPHRLFQGLGKLEYLLLSRNR--------L 508

  Fly   412 CEFPERLRGESLRHLNPAM-MGCTHADPRKQALIGALLVGSAATITALALVLYRCRHKIRETIKG 475
            .|.|    .::|..|..|. :..:|  .|.:||..:||                           
Human   509 AELP----ADALGPLQRAFWLDVSH--NRLEALPNSLL--------------------------- 540

  Fly   476 GLWGNSALGRKEREYQKTFCDEDYMSRHQHHPCSLGIHSTFPNTYTAPHHPGATHHY-------- 532
                 :.|||..           |:|          :.:....|:| |..||....:        
Human   541 -----APLGRLR-----------YLS----------LRNNSLRTFT-PQPPGLERLWLEGNPWDC 578

  Fly   533 GMCPMPVNDLGAIDPQQKFQQLVVPTATMISEKKLNNNKALVSQGAIDDSASFVLHMKSATMGRD 597
            | ||:                                 |||                      ||
Human   579 G-CPL---------------------------------KAL----------------------RD 587

  Fly   598 VHQQNPQLNHYTKPQFLSATATVGDSC----YSY-----ADVPMVHGAPLGGPNQPQLRLTQEHF 653
            ...|||.    ..|:|:.|... ||.|    |:|     |..|.|.|..|..       |::.||
Human   588 FALQNPS----AVPRFVQAICE-GDDCQPPAYTYNNITCASPPEVVGLDLRD-------LSEAHF 640

  Fly   654  653
            Human   641  640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 3/18 (17%)
LRR_8 83..142 CDD:290566 19/82 (23%)
leucine-rich repeat 84..107 CDD:275380 9/46 (20%)
leucine-rich repeat 108..131 CDD:275380 6/22 (27%)
LRR_RI 129..421 CDD:238064 98/320 (31%)
LRR_8 132..190 CDD:290566 23/57 (40%)
leucine-rich repeat 132..155 CDD:275380 7/22 (32%)
leucine-rich repeat 156..179 CDD:275380 11/22 (50%)
leucine-rich repeat 180..204 CDD:275380 9/23 (39%)
LRR_8 203..263 CDD:290566 22/59 (37%)
leucine-rich repeat 205..228 CDD:275380 7/22 (32%)
leucine-rich repeat 229..252 CDD:275380 7/22 (32%)
LRR_8 252..308 CDD:290566 20/55 (36%)
leucine-rich repeat 253..276 CDD:275380 7/22 (32%)
leucine-rich repeat 277..300 CDD:275380 10/22 (45%)
leucine-rich repeat 301..322 CDD:275380 7/20 (35%)
LRR_8 325..384 CDD:290566 21/82 (26%)
leucine-rich repeat 326..350 CDD:275380 7/46 (15%)
leucine-rich repeat 351..373 CDD:275380 7/22 (32%)
IGFALSNP_001139478.1 LRRNT 78..116 CDD:214470 12/38 (32%)
leucine-rich repeat 95..113 CDD:275380 5/17 (29%)
leucine-rich repeat 114..137 CDD:275380 4/22 (18%)
leucine-rich repeat 138..161 CDD:275380 4/22 (18%)
LRR_8 141..196 CDD:290566 10/54 (19%)
leucine-rich repeat 162..185 CDD:275380 5/22 (23%)
LRR_8 184..244 CDD:290566 17/59 (29%)
leucine-rich repeat 186..209 CDD:275380 6/22 (27%)
leucine-rich repeat 210..233 CDD:275380 7/22 (32%)
leucine-rich repeat 234..257 CDD:275380 11/22 (50%)
LRR_8 257..316 CDD:290566 21/59 (36%)
leucine-rich repeat 258..281 CDD:275380 9/23 (39%)
leucine-rich repeat 282..305 CDD:275380 7/22 (32%)
leucine-rich repeat 306..324 CDD:275380 4/17 (24%)
LRR_8 336..388 CDD:290566 16/52 (31%)
leucine-rich repeat 354..377 CDD:275380 10/22 (45%)
LRR_8 377..433 CDD:290566 13/56 (23%)
leucine-rich repeat 378..401 CDD:275380 7/23 (30%)
leucine-rich repeat 402..423 CDD:275380 4/20 (20%)
LRR_8 425..484 CDD:290566 16/58 (28%)
leucine-rich repeat 426..447 CDD:275380 1/20 (5%)
leucine-rich repeat 450..473 CDD:275380 7/22 (32%)
leucine-rich repeat 474..497 CDD:275380 6/22 (27%)
LRR_8 476..532 CDD:290566 16/69 (23%)
leucine-rich repeat 498..519 CDD:275380 8/32 (25%)
leucine-rich repeat 522..543 CDD:275380 7/54 (13%)
LRR_8 524..575 CDD:290566 16/106 (15%)
leucine-rich repeat 546..565 CDD:275380 5/40 (13%)
TPKR_C2 574..618 CDD:301599 19/104 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.