DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and Toll-4

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_523519.2 Gene:Toll-4 / 34235 FlyBaseID:FBgn0032095 Length:1125 Species:Drosophila melanogaster


Alignment Length:430 Identity:87/430 - (20%)
Similarity:152/430 - (35%) Gaps:129/430 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SIGVEPAAGLANCPPGCQC----DDNTLVVQCGEGQLDVLPIALNP--SIQRLVIKSNKIKTI-D 75
            ::|:...|    ||..|.|    |.:.|.:.|.:..|..:|....|  ....||.:||.:..: |
  Fly   364 TLGINEVA----CPLKCNCSYNRDKSQLEIDCWQKNLTTIPSLPVPKKGSSALVFQSNLLAELPD 424

  Fly    76 SSIQFYAELTFLDLSSNHL--MTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLR 138
            :|::.|..|..||:|.|.|  :::.|    ..:.|..:.:.||||..:|.:....|.:|.|.|..
  Fly   425 NSLEGYHNLKSLDVSYNQLTSLSVSQ----LPESLHYLDIRHNKITTLSPQVVEYLYSVNVFNQY 485

  Fly   139 GNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVIFQAMP 203
            ||:.|                                       :|.|:.               
  Fly   486 GNKWS---------------------------------------IYCDEY--------------- 496

  Fly   204 SLAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLSDNRLDRIPS 268
            .|.|.|.....|..|:...||.:.....|..||:.:.|..      :|.:..|.|..|..:.|.:
  Fly   497 HLQEFFWYKAKLLRIKTSKFQTIMEYIELSSKGSFVENFF------VQNIDQLYLEANEDEIIDA 555

  Fly   269 VGLS----KLVRLEQLS----LGQNDFEVI-------------------SEGAFM---------- 296
            .|.|    .|..:|.|:    |...:|:.|                   ..|.|:          
  Fly   556 FGPSDKYFNLKLMEALNHAIWLFSGEFDEIILHHLNSPCPYRCSCCFEWHTGEFLINCRNLSLDI 620

  Fly   297 --------GLKQLKRLEVNGALRLKRVMTGAFSDNGNLEYLNLSSNKMLLEVQEGALSGLSQLKH 353
                    ..|....|:.|...:|....:...:.:.::..|::|.| :|.|:....|.  ..:.:
  Fly   621 YPRLPNSIPYKTTLYLDRNEIRKLTNTESLVVAGHASIHKLHMSQN-LLRELPLHLLP--ENITY 682

  Fly   354 VVLKANALTSLAEGLFPW----KDLQTLDLSENPLSCDCR 389
            :.::.|.|..|.:|:..:    :::..::||.||..|:|:
  Fly   683 LDVRNNLLKYLDDGVIAFLEYRENITKIELSGNPWECNCK 722

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 6/18 (33%)
LRR_8 83..142 CDD:290566 19/60 (32%)
leucine-rich repeat 84..107 CDD:275380 7/24 (29%)
leucine-rich repeat 108..131 CDD:275380 7/22 (32%)
LRR_RI 129..421 CDD:238064 55/310 (18%)
LRR_8 132..190 CDD:290566 8/57 (14%)
leucine-rich repeat 132..155 CDD:275380 6/22 (27%)
leucine-rich repeat 156..179 CDD:275380 0/22 (0%)
leucine-rich repeat 180..204 CDD:275380 2/23 (9%)
LRR_8 203..263 CDD:290566 15/59 (25%)
leucine-rich repeat 205..228 CDD:275380 7/22 (32%)
leucine-rich repeat 229..252 CDD:275380 4/22 (18%)
LRR_8 252..308 CDD:290566 16/100 (16%)
leucine-rich repeat 253..276 CDD:275380 7/26 (27%)
leucine-rich repeat 277..300 CDD:275380 7/63 (11%)
leucine-rich repeat 301..322 CDD:275380 3/20 (15%)
LRR_8 325..384 CDD:290566 13/62 (21%)
leucine-rich repeat 326..350 CDD:275380 6/23 (26%)
leucine-rich repeat 351..373 CDD:275380 4/25 (16%)
Toll-4NP_523519.2 leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380
leucine-rich repeat 335..386 CDD:275380 7/25 (28%)
leucine-rich repeat 388..408 CDD:275380 4/19 (21%)
LRR_8 412..465 CDD:290566 17/56 (30%)
leucine-rich repeat 412..432 CDD:275378 7/19 (37%)
LRR_4 432..470 CDD:289563 12/41 (29%)
leucine-rich repeat 433..454 CDD:275378 7/24 (29%)
leucine-rich repeat 455..478 CDD:275378 7/22 (32%)
leucine-rich repeat 479..490 CDD:275378 5/10 (50%)
leucine-rich repeat 632..657 CDD:275378 3/24 (13%)
leucine-rich repeat 658..679 CDD:275378 6/23 (26%)
leucine-rich repeat 680..706 CDD:275378 4/25 (16%)
leucine-rich repeat 707..719 CDD:275378 4/11 (36%)
leucine-rich repeat 771..791 CDD:275380
leucine-rich repeat 793..815 CDD:275378
leucine-rich repeat 816..835 CDD:275378
leucine-rich repeat 836..859 CDD:275378
TIR 974..1110 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453533
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.