DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and LINGO4

DIOPT Version :10

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001004432.1 Gene:LINGO4 / 339398 HGNCID:31814 Length:593 Species:Homo sapiens


Alignment Length:463 Identity:134/463 - (28%)
Similarity:196/463 - (42%) Gaps:94/463 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 WCILASIGVEPAAGLANCPPGCQCDDNTLVVQCGEGQLDVLPIALNPSIQRLVIKSNKIKTIDSS 77
            |..|..:.:.|.....:||..|.|......|.||..||:.:|..|....:.|.:..|::..:...
Human    14 WPPLLFLLLLPGGSGGSCPAVCDCTSQPQAVLCGHRQLEAVPGGLPLDTELLDLSGNRLWGLQQG 78

  Fly    78 -IQFYAELTFLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLRGNQ 141
             :...:.|..||||.|.|.|:....|...:.|..:.|..|::..:....|.||||:|:|:||.||
Human    79 MLSRLSLLQELDLSYNQLSTLEPGAFHGLQSLLTLRLQGNRLRIMGPGVFSGLSALTLLDLRLNQ 143

  Fly   142 ISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVIFQAMPSLA 206
            |.....|.|..|..:::|.:|:|.:.::.|.||.||::|..|.|:...|:|||. :....:|:|.
Human   144 IVLFLDGAFGELGSLQKLEVGDNHLVFVAPGAFAGLAKLSTLTLERCNLSTVPG-LALARLPALV 207

  Fly   207 ELFL--------------GMNTLQSIQADAFQDLKGL---------------TRLELKGASLRNI 242
            .|.|              |:..|:.::...:..|:.|               ||..|.....:.:
Human   208 ALRLRELDIGRLPAGALRGLGQLKELEIHLWPSLEALDPGSLVGLNLSSLAITRCNLSSVPFQAL 272

  Fly   243 SHDSFLGLQELRILDLSDNRLDRIPSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVN 307
            .|.||     ||:||||.|.:..||:..||.||||::|.|.......|:..||.||.        
Human   273 YHLSF-----LRVLDLSQNPISAIPARRLSPLVRLQELRLSGACLTSIAAHAFHGLT-------- 324

  Fly   308 GALRLKRVMTGAFSDNGNLEYLNLSSNKMLLEVQEGALSGLSQLKHVVLKANALTSLAEGLFPWK 372
                       ||.               ||:|.:                |||.:|.|..||..
Human   325 -----------AFH---------------LLDVAD----------------NALQTLEETAFPSP 347

  Fly   373 D-LQTLDLSENPLSCDCRVMWLHNLLVAKNASQDDVSELLCEFPERLRGESLRH----LNPAMMG 432
            | |.||.||.|||:||||::||..|   :......:|...|..|..::|:||:.    |.|....
Human   348 DKLVTLRLSGNPLTCDCRLLWLLRL---RRHLDFGMSPPACAGPHHVQGKSLKEFSDILPPGHFT 409

  Fly   433 CTHADPRK 440
            |..|..||
Human   410 CKPALIRK 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 2/18 (11%)
LRR 82..406 CDD:443914 106/353 (30%)
leucine-rich repeat 84..107 CDD:275380 9/22 (41%)
leucine-rich repeat 108..131 CDD:275380 6/22 (27%)
leucine-rich repeat 132..155 CDD:275380 10/22 (45%)
leucine-rich repeat 156..179 CDD:275380 8/22 (36%)
leucine-rich repeat 180..204 CDD:275380 7/23 (30%)
leucine-rich repeat 205..228 CDD:275380 6/36 (17%)
leucine-rich repeat 229..252 CDD:275380 7/37 (19%)
leucine-rich repeat 253..276 CDD:275380 12/22 (55%)
leucine-rich repeat 277..300 CDD:275380 8/22 (36%)
leucine-rich repeat 301..322 CDD:275380 2/20 (10%)
leucine-rich repeat 326..350 CDD:275380 3/23 (13%)
leucine-rich repeat 351..373 CDD:275380 7/21 (33%)
LRRCT 382..434 CDD:214507 18/55 (33%)
LINGO4NP_001004432.1 LRRNT 31..64 CDD:214470 11/32 (34%)
leucine-rich repeat 62..85 CDD:275380 2/22 (9%)
LRR <63..342 CDD:443914 89/334 (27%)
leucine-rich repeat 86..109 CDD:275380 9/22 (41%)
leucine-rich repeat 110..133 CDD:275380 6/22 (27%)
leucine-rich repeat 134..157 CDD:275380 10/22 (45%)
leucine-rich repeat 158..181 CDD:275380 8/22 (36%)
leucine-rich repeat 182..205 CDD:275380 7/23 (30%)
leucine-rich repeat 206..229 CDD:275380 4/22 (18%)
leucine-rich repeat 230..277 CDD:275380 7/46 (15%)
leucine-rich repeat 278..301 CDD:275380 12/22 (55%)
leucine-rich repeat 302..325 CDD:275380 8/41 (20%)
leucine-rich repeat 326..344 CDD:275380 9/48 (19%)
leucine-rich repeat 350..362 CDD:275378 8/11 (73%)
IG_like 420..501 CDD:214653
Ig strand B 431..435 CDD:409353
Ig strand C 444..448 CDD:409353
Ig strand E 467..471 CDD:409353
Ig strand F 481..486 CDD:409353
Ig strand G 494..497 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.