DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and Lrrtm3

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001099857.1 Gene:Lrrtm3 / 294380 RGDID:1304866 Length:582 Species:Rattus norvegicus


Alignment Length:598 Identity:132/598 - (22%)
Similarity:215/598 - (35%) Gaps:185/598 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CPPGCQCDDNTLVVQCGEGQLDVLPIALNPSIQRLVIKSNKIKTIDSSIQFYAELTFLDLSSNHL 94
            ||.||:|:..  :|.|                     :|.|::.|.|||.  |....|.|..|.|
  Rat    34 CPKGCRCEGK--MVYC---------------------ESQKLQEIPSSIS--AGCLGLSLRYNSL 73

  Fly    95 MTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLRGNQISELHQGTFTPLLKIEEL 159
            ..:....|....:|..::|:||.|..|....|.|:..:..|.|..|:||.....||.|:..:..|
  Rat    74 QKLKYNQFKGLNQLTWLYLDHNHISNIDENAFNGIRRLKELILSSNRISYFLNNTFRPVTNLRNL 138

  Fly   160 NLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVIFQAMPSLAELFLGMNTLQSIQADAFQ 224
            :|..|::..|..:.|.||.:|..|:|..|:|.|:|..:                         ||
  Rat   139 DLSYNQLHSLGSEQFRGLRKLLSLHLRSNSLRTIPVRI-------------------------FQ 178

  Fly   225 DLKGLTRLELKGASLRNISHDSFLGLQELRILDLSDNRLDRIPSVGLSKLVRLEQLSLGQNDFEV 289
            |.:.|..|:|....:|:::.:.|.|:..|:.|.|..|:..::......:||.|:.|.:..|...|
  Rat   179 DCRNLELLDLGYNRIRSLARNVFAGMIRLKELHLEHNQFSKLNLALFPRLVSLQNLYMQWNKISV 243

  Fly   290 ISEGAFMGLKQLKRLEVNGALRLKRVMTGAFSDNG------NLEYLNLSSNKMLLEVQEGALSGL 348
            |.:........|:||:::|.      ...|||...      ||:.|||.|||:....||      
  Rat   244 IGQTMSWTWSSLQRLDLSGN------EIEAFSGPSVFQCVPNLQRLNLDSNKLTFIGQE------ 296

  Fly   349 SQLKHVVLKANALTSLAEGLFPWKDLQTLDLSENPLSCDCRVMWLHNLLVAKNASQDDVSELLCE 413
                  :|.:            |..|..:.|:.|...|...:..|.|.|.:....:::.  :||.
  Rat   297 ------ILDS------------WISLNDISLAGNIWECSRNICSLVNWLKSFKGLRENT--ILCA 341

  Fly   414 FPERLRGESL-------------------------------------RHLN----PAMMGCTHAD 437
            .|:.|:|.::                                     :|.:    |..:|.:...
  Rat   342 SPKELQGVNVIDAVKNYSICGKSTTTERFDLARALPKPTFKPKLPRPKHESKPPLPPTVGASEPS 406

  Fly   438 PR-----KQALIGALLVGSAA---TITALALVLY--------------------RCRHKIRETIK 474
            |.     :......::.||.|   ::..:.||:|                    |.|.|.|:::|
  Rat   407 PETDVDTEHISFHKIIAGSVALFLSVLVILLVMYVSWKRYPASMKQLQQRSLMRRHRKKKRQSLK 471

  Fly   475 GGLWGNSALGRKE--REYQKTFCDEDYM--------------SRHQHHPCSLGIHSTF-----PN 518
                 ....|.:|  .:|:.|..:...|              ||....|.|:.: |||     |.
  Rat   472 -----QMTPGTQEFYVDYKPTNTETSEMLLNGTGPCTYSKSGSRECEIPLSMNV-STFLAYDQPT 530

  Fly   519 -TYTAPHHPGATH 530
             :|...||...:|
  Rat   531 ISYCGVHHELLSH 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 6/17 (35%)
LRR_8 83..142 CDD:290566 16/58 (28%)
leucine-rich repeat 84..107 CDD:275380 5/22 (23%)
leucine-rich repeat 108..131 CDD:275380 8/22 (36%)
LRR_RI 129..421 CDD:238064 72/297 (24%)
LRR_8 132..190 CDD:290566 19/57 (33%)
leucine-rich repeat 132..155 CDD:275380 8/22 (36%)
leucine-rich repeat 156..179 CDD:275380 7/22 (32%)
leucine-rich repeat 180..204 CDD:275380 7/23 (30%)
LRR_8 203..263 CDD:290566 13/59 (22%)
leucine-rich repeat 205..228 CDD:275380 3/22 (14%)
leucine-rich repeat 229..252 CDD:275380 6/22 (27%)
LRR_8 252..308 CDD:290566 14/55 (25%)
leucine-rich repeat 253..276 CDD:275380 5/22 (23%)
leucine-rich repeat 277..300 CDD:275380 5/22 (23%)
leucine-rich repeat 301..322 CDD:275380 6/20 (30%)
LRR_8 325..384 CDD:290566 15/58 (26%)
leucine-rich repeat 326..350 CDD:275380 9/23 (39%)
leucine-rich repeat 351..373 CDD:275380 2/21 (10%)
Lrrtm3NP_001099857.1 LRRNT 33..61 CDD:214470 13/51 (25%)
LRR 1 61..83 6/21 (29%)
leucine-rich repeat 66..86 CDD:275380 5/19 (26%)
LRR_RI <81..300 CDD:238064 69/261 (26%)
LRR 2 84..107 7/22 (32%)
LRR_8 86..145 CDD:290566 19/58 (33%)
leucine-rich repeat 87..110 CDD:275380 8/22 (36%)
LRR 3 109..131 7/21 (33%)
leucine-rich repeat 111..134 CDD:275380 8/22 (36%)
LRR 4 132..155 5/22 (23%)
LRR_8 133..193 CDD:290566 20/84 (24%)
leucine-rich repeat 135..158 CDD:275380 7/22 (32%)
LRR 5 156..179 9/47 (19%)
leucine-rich repeat 159..182 CDD:275380 10/47 (21%)
LRR_8 181..241 CDD:290566 15/59 (25%)
LRR 6 181..203 5/21 (24%)
leucine-rich repeat 183..206 CDD:275380 6/22 (27%)
LRR 7 205..227 4/21 (19%)
leucine-rich repeat 207..230 CDD:275380 5/22 (23%)
LRR 8 229..251 6/21 (29%)
LRR_8 230..290 CDD:290566 19/65 (29%)
leucine-rich repeat 231..254 CDD:275380 5/22 (23%)
LRR 9 252..276 7/29 (24%)
leucine-rich repeat 255..279 CDD:275380 7/29 (24%)
LRR 10 277..300 11/34 (32%)
leucine-rich repeat 280..300 CDD:275380 10/31 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..411 4/32 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.