DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and Lrrc66

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001008763.1 Gene:Lrrc66 / 289587 RGDID:1306094 Length:865 Species:Rattus norvegicus


Alignment Length:780 Identity:153/780 - (19%)
Similarity:231/780 - (29%) Gaps:324/780 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SNKIKTIDSSIQFYAELTFLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAV 132
            |.|..|:|.:..|:..|                   :|...:|.|.||                 
  Rat    50 SQKTDTVDRNSYFFRVL-------------------FQPHTKERHTNH----------------- 78

  Fly   133 TVLNLRGNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPV 197
              |:...:::|::.......|..:|.||||::.|              ..|.||           
  Rat    79 --LDRTNHRLSKVTLSCLAHLRALEMLNLGDDVI--------------HSLCLD----------- 116

  Fly   198 IFQAMPSLAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQ-ELRILDLSDN 261
                                              |.|..:|.:......|.|.. .|::|.|..|
  Rat   117 ----------------------------------LSLPSSSRQKRHRSRFRGRHPRLKVLLLQRN 147

  Fly   262 RLDRIPSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALRLKRVMTGAFSDNGNL 326
            :|...|. ||.||..|..|.|..|....|....|.|..|||.:                      
  Rat   148 QLGPTPK-GLWKLKPLCSLDLSFNRRVGIGLSGFHGCLQLKSI---------------------- 189

  Fly   327 EYLNLSSNKMLLEVQEGALSGLSQLKHVVLKANALTSLAEGL---FPWKDLQTLDLSENPLSCDC 388
             ||   .|..:|.:...|..||.:|:.|.|:::|||.|...:   ..|.:|: |.|::|...|:.
  Rat   190 -YL---KNNKILTIHPEAFKGLKKLQVVDLRSSALTMLVPIVTIALEWPNLE-LGLADNQWQCNE 249

  Fly   389 RVMWLHNLLVAKNASQDDVSELLCEFPER-----LRGESLR-----HLNPAMMGCTHADPRK--- 440
            ......|:   .:.|..::.:.:|..|..     :....:|     ||           ||.   
  Rat   250 SDANFQNI---ASVSWGEIWKAVCNTPVENEKPYVEASQIRISRDIHL-----------PRSPSS 300

  Fly   441 --QALIGALL----VGSAATITAL---ALVLYRCRHKIRETIKGGLW-----------GNSALGR 485
              |:||.:..    .|....::||   |.|.|       ..:| |:|           |.....|
  Rat   301 DLQSLIQSKAEKPRAGMDVHLSALEKKAQVGY-------GDLK-GIWLQSPMELRDSQGGPVTDR 357

  Fly   486 KERE---------------YQKTFC----DEDYMSRHQHHPC------------SLGIHSTFPNT 519
            |:.:               :...||    ...|:.|.:...|            :.|.|.   :.
  Rat   358 KDDKPPDLALAVCLSVFITFVVAFCLGAFARPYIDRLRQQRCLNKRPGSENAYSNEGFHD---DV 419

  Fly   520 YTAPH--HPG-----ATHHYGMCPMPVNDLGAIDPQQKFQQLVVPTATMISEKKLNNN----KAL 573
            ..|.|  |.|     .|||       :|.....||....:  .:|...::||:.|.:|    .:.
  Rat   420 EAAQHVQHQGTDLCQTTHH-------LNLFENQDPSWGTE--AIPHGAVLSERMLGSNGMDPSSQ 475

  Fly   574 VSQGAIDDSASF------------VLH-----MKSATMGRDVHQQNPQLNHYTKPQFLSATATVG 621
            .|.|..:||...            |:|     :.||...:.:   :|..:||..|: .|...||.
  Rat   476 QSPGQFEDSGEARSGDGNMFPNGRVVHPAVHGLPSADAQKPI---SPGQHHYDVPE-ESLYDTVA 536

  Fly   622 DSCYSYADVPMVHGAPLG----------------GPNQPQ-----LRLTQEHFKQRELYDQ---- 661
            .. ||..|..|...:..|                .|:||:     ...|..|...||..:.    
  Rat   537 QE-YSLLDNAMDRSSVAGCLGTFPNSINSGRDELCPSQPRDVVASFSKTLAHMSTREAEESVERG 600

  Fly   662 ------EMGSEI------------------------------LDHNY---IYSNTHYSMPLEQLG 687
                  .|||:|                              |.|.|   :|::|...||....|
  Rat   601 FPEPLGAMGSQIESSEERQVSNSIRELATQQASFQEVDVEERLAHVYSEALYNDTPSHMPRHSSG 665

  Fly   688  687
              Rat   666  665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 4/11 (36%)
LRR_8 83..142 CDD:290566 7/58 (12%)
leucine-rich repeat 84..107 CDD:275380 2/22 (9%)
leucine-rich repeat 108..131 CDD:275380 4/22 (18%)
LRR_RI 129..421 CDD:238064 61/300 (20%)
LRR_8 132..190 CDD:290566 12/57 (21%)
leucine-rich repeat 132..155 CDD:275380 3/22 (14%)
leucine-rich repeat 156..179 CDD:275380 6/22 (27%)
leucine-rich repeat 180..204 CDD:275380 3/23 (13%)
LRR_8 203..263 CDD:290566 9/60 (15%)
leucine-rich repeat 205..228 CDD:275380 0/22 (0%)
leucine-rich repeat 229..252 CDD:275380 5/23 (22%)
LRR_8 252..308 CDD:290566 20/55 (36%)
leucine-rich repeat 253..276 CDD:275380 10/22 (45%)
leucine-rich repeat 277..300 CDD:275380 7/22 (32%)
leucine-rich repeat 301..322 CDD:275380 2/20 (10%)
LRR_8 325..384 CDD:290566 19/61 (31%)
leucine-rich repeat 326..350 CDD:275380 7/23 (30%)
leucine-rich repeat 351..373 CDD:275380 8/24 (33%)
Lrrc66NP_001008763.1 leucine-rich repeat 78..99 CDD:275380 4/39 (10%)
LRR_RI <135..>243 CDD:238064 38/135 (28%)
LRR 1 138..160 9/22 (41%)
leucine-rich repeat 139..161 CDD:275380 10/22 (45%)
LRR 2 161..182 6/20 (30%)
leucine-rich repeat 162..185 CDD:275380 7/22 (32%)
LRR_8 164..220 CDD:290566 19/81 (23%)
LRR 3 185..206 8/46 (17%)
leucine-rich repeat 186..209 CDD:275380 9/48 (19%)
LRR 4 209..230 7/20 (35%)
leucine-rich repeat 210..235 CDD:275380 8/24 (33%)
LRR 5 235..255 5/20 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 463..522 11/61 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 654..749 4/12 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 840..865
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.