DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and Elfn1

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001099383.1 Gene:Elfn1 / 288512 RGDID:1308787 Length:829 Species:Rattus norvegicus


Alignment Length:467 Identity:100/467 - (21%)
Similarity:151/467 - (32%) Gaps:145/467 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 LDLSDNRLDRIPSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALRLKRVMTGAF 320
            |.|::||:..:....||:...|..|:|.:|:...|.:|||.|...|:.|:: |..||:.:..|..
  Rat    65 LRLNENRIRSVQYASLSRFGNLTYLNLTKNEIGYIEDGAFSGQFNLQVLQL-GYNRLRNLTEGML 128

  Fly   321 SDNGNLEYLNLSSNKMLLE-VQEGALSGLSQLKHVVLKANALTSLAEGLFP-WKDLQTLDLSENP 383
            .....||||.|.:|  |:| |...|......:.::.|..|.:..|..|.|. ...|...::..||
  Rat   129 RGLSKLEYLYLQAN--LIEVVMASAFWECPNIVNIDLSMNRIQQLGSGTFAGLTKLSVCEIYSNP 191

  Fly   384 LSCDCRVM-WLHNLLVAKNASQDDVSELLCEFPERLRGESLRHLNPAMMGCTHADPRKQALIGAL 447
            ..|.|.:: :|..|....||:|.. ..:.||.|                         ....|..
  Rat   192 FYCSCELLGFLRWLAAFTNATQTH-DRVQCESP-------------------------PVYAGYF 230

  Fly   448 LVGSAATITALALVLYRCRHKIRETIKGGLWGNSALGRKEREYQKTFCDEDYMSRHQHHPCSLGI 512
            |:|..             ||..:.:|...|              ::.|.|...:.....|     
  Rat   231 LLGQG-------------RHGHQRSILSKL--------------QSVCTEGSYTAEVLGP----- 263

  Fly   513 HSTFPNTYTAPHHPGATHHYGMCPMPVNDLGAIDPQ----QKFQQLVVPTATMISE--------- 564
                |........||  |.....|...:|:...|.:    .....|||.| |::.:         
  Rat   264 ----PRPVPGRSQPG--HSPPPPPPEPSDMPCADDECFSGDGTTPLVVLT-TLVPQTEARPSMKV 321

  Fly   565 KKLNNNKALVSQGAIDDSASFVLHMKSATMGRDVHQQNPQLNHYTKPQF-LSATATVGDSCYSYA 628
            |:|..|.|.:.                      |...:|....||..|: .|.:.||.       
  Rat   322 KQLTQNSATIM----------------------VQLPSPFNRMYTLEQYNNSKSFTVS------- 357

  Fly   629 DVPMVHGAPLGGPNQPQLRLTQEHFKQRELYDQEMGSEILDHNYIY------SNTHYSMPLEQLG 687
                            :|...||..:...||...        ||.|      |.||::.....:.
  Rat   358 ----------------KLTQPQEEIRLTNLYTLT--------NYTYCVVSTSSGTHHNHTCLTIC 398

  Fly   688 RSKTPTPP-PMP 698
            ..|.|:|| |:|
  Rat   399 LPKPPSPPGPVP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380
LRR_8 83..142 CDD:290566
leucine-rich repeat 84..107 CDD:275380
leucine-rich repeat 108..131 CDD:275380
LRR_RI 129..421 CDD:238064 49/167 (29%)
LRR_8 132..190 CDD:290566
leucine-rich repeat 132..155 CDD:275380
leucine-rich repeat 156..179 CDD:275380
leucine-rich repeat 180..204 CDD:275380
LRR_8 203..263 CDD:290566 3/6 (50%)
leucine-rich repeat 205..228 CDD:275380
leucine-rich repeat 229..252 CDD:275380
LRR_8 252..308 CDD:290566 17/51 (33%)
leucine-rich repeat 253..276 CDD:275380 6/19 (32%)
leucine-rich repeat 277..300 CDD:275380 9/22 (41%)
leucine-rich repeat 301..322 CDD:275380 6/20 (30%)
LRR_8 325..384 CDD:290566 17/60 (28%)
leucine-rich repeat 326..350 CDD:275380 10/24 (42%)
leucine-rich repeat 351..373 CDD:275380 5/22 (23%)
Elfn1NP_001099383.1 LRR <44..>186 CDD:227223 37/123 (30%)
leucine-rich repeat 65..85 CDD:275378 6/19 (32%)
LRR_8 85..144 CDD:404697 21/61 (34%)
leucine-rich repeat 86..109 CDD:275378 9/22 (41%)
leucine-rich repeat 110..133 CDD:275378 6/23 (26%)
leucine-rich repeat 134..157 CDD:275378 10/24 (42%)
leucine-rich repeat 158..171 CDD:275378 2/12 (17%)
LRRCT 190..>228 CDD:214507 12/63 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.