DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and GP5

DIOPT Version :10

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_004479.1 Gene:GP5 / 2814 HGNCID:4443 Length:560 Species:Homo sapiens


Alignment Length:429 Identity:110/429 - (25%)
Similarity:179/429 - (41%) Gaps:70/429 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CPPGCQC---DDNTLVVQCGEGQL-DVLPIALNPSIQRLVIKSNKIKTIDSSIQFYAELTFLD-- 88
            |||.|:|   |    ..||..|.: .:..:.|..::..:::.......:.|  |.::.:|.|.  
Human    21 CPPACKCVFRD----AAQCSGGDVARISALGLPTNLTHILLFGMGRGVLQS--QSFSGMTVLQRL 79

  Fly    89 -LSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLRGNQISELHQGTFTP 152
             :|.:|:..:...||:...||:.:.|:.|||..:.......:..:..|.|..|.:..:.|..|..
Human    80 MISDSHISAVAPGTFSDLIKLKTLRLSRNKITHLPGALLDKMVLLEQLFLDHNALRGIDQNMFQK 144

  Fly   153 LLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVP----------------------- 194
            |:.::||.|.:|::.:|....|..|..|::|.|..|.||.:|                       
Human   145 LVNLQELALNQNQLDFLPASLFTNLENLKLLDLSGNNLTHLPKGLLGAQAKLERLLLHSNRLVSL 209

  Fly   195 DPVIFQAMPSLAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLS 259
            |..:..::.:|.||....|.::||...||..|..|:.|.|....|..:....||....|.:|.|.
Human   210 DSGLLNSLGALTELQFHRNHIRSIAPGAFDRLPNLSSLTLSRNHLAFLPSALFLHSHNLTLLTLF 274

  Fly   260 DNRLDRIPSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALRLKRVMTGAFSDNG 324
            :|.|..:|.|...::..|::|.|.:.....:...||..|.:|:.|.|..:.||..:..|||...|
Human   275 ENPLAELPGVLFGEMGGLQELWLNRTQLRTLPAAAFRNLSRLRYLGVTLSPRLSALPQGAFQGLG 339

  Fly   325 NLEYLNLSSNKMLLEVQEGALSGLSQLKHVVLKANALTSLAEGLFPWKDLQTLD----------- 378
            .|:.|.|.||. |..:.:|.|.||.:|:.|.|:.|.|.:|...||  ::|.:|:           
Human   340 ELQVLALHSNG-LTALPDGLLRGLGKLRQVSLRRNRLRALPRALF--RNLSSLESVQLDHNQLET 401

  Fly   379 ----------------LSENPLSCDCR----VMWLHNLL 397
                            |..|...|||.    :.||...|
Human   402 LPGDVFGALPRLTEVLLGHNSWRCDCGLGPFLGWLRQHL 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 1/17 (6%)
LRR 82..406 CDD:443914 98/373 (26%)
leucine-rich repeat 84..107 CDD:275380 6/25 (24%)
leucine-rich repeat 108..131 CDD:275380 5/22 (23%)
leucine-rich repeat 132..155 CDD:275380 6/22 (27%)
leucine-rich repeat 156..179 CDD:275380 7/22 (32%)
leucine-rich repeat 180..204 CDD:275380 8/46 (17%)
leucine-rich repeat 205..228 CDD:275380 9/22 (41%)
leucine-rich repeat 229..252 CDD:275380 6/22 (27%)
leucine-rich repeat 253..276 CDD:275380 7/22 (32%)
leucine-rich repeat 277..300 CDD:275380 6/22 (27%)
leucine-rich repeat 301..322 CDD:275380 8/20 (40%)
leucine-rich repeat 326..350 CDD:275380 10/23 (43%)
leucine-rich repeat 351..373 CDD:275380 8/21 (38%)
LRRCT 382..434 CDD:214507 7/20 (35%)
GP5NP_004479.1 LRR <44..>299 CDD:443914 61/256 (24%)
LRR 1 75..96 5/20 (25%)
leucine-rich repeat 76..99 CDD:275380 5/22 (23%)
LRR 2 99..120 6/20 (30%)
leucine-rich repeat 100..123 CDD:275380 5/22 (23%)
LRR 3 123..144 5/20 (25%)
leucine-rich repeat 124..147 CDD:275380 6/22 (27%)
LRR 4 147..168 6/20 (30%)
leucine-rich repeat 148..171 CDD:275380 7/22 (32%)
LRR 5 171..193 7/21 (33%)
leucine-rich repeat 172..195 CDD:275380 7/22 (32%)
LRR 6 195..216 1/20 (5%)
leucine-rich repeat 196..219 CDD:275380 1/22 (5%)
LRR 7 219..240 8/20 (40%)
leucine-rich repeat 220..243 CDD:275380 9/22 (41%)
LRR 8 243..264 5/20 (25%)
leucine-rich repeat 244..267 CDD:275380 6/22 (27%)
LRR 9 267..288 7/20 (35%)
leucine-rich repeat 268..291 CDD:275380 7/22 (32%)
LRR_8 291..351 CDD:404697 20/60 (33%)
LRR 10 291..312 5/20 (25%)
leucine-rich repeat 292..315 CDD:275380 6/22 (27%)
leucine-rich repeat 316..338 CDD:275380 8/21 (38%)
LRR_8 340..399 CDD:404697 20/61 (33%)
LRR 11 340..361 8/21 (38%)
leucine-rich repeat 341..364 CDD:275380 10/23 (43%)
LRR 12 364..385 8/22 (36%)
leucine-rich repeat 365..388 CDD:275380 9/24 (38%)
LRR 13 388..409 1/20 (5%)
leucine-rich repeat 389..410 CDD:275380 1/20 (5%)
LRRCT 421..472 CDD:214507 7/20 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 469..498
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.