DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and GP1BA

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_000164.5 Gene:GP1BA / 2811 HGNCID:4439 Length:652 Species:Homo sapiens


Alignment Length:293 Identity:82/293 - (27%)
Similarity:125/293 - (42%) Gaps:53/293 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 SELHQGTFTPLLKIE---ELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVIFQAMPS 204
            |.||......:.|:.   |:|..:..:..|.|   |......||:|.:|.|.|.          |
Human    12 SPLHPHPICEVSKVASHLEVNCDKRNLTALPP---DLPKDTTILHLSENLLYTF----------S 63

  Fly   205 LAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLSDNRLDRIPSV 269
            ||.| :....|..:..|..:    ||:|::.|.            |..|..||||.|:|..:|.:
Human    64 LATL-MPYTRLTQLNLDRCE----LTKLQVDGT------------LPVLGTLDLSHNQLQSLPLL 111

  Fly   270 GLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALRLKRVMTGAFSDNGNLEYLNLSSN 334
            | ..|..|..|.:..|....:..||..||.:|:.|.:.|. .||.:..|..:....||.|:|::|
Human   112 G-QTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGN-ELKTLPPGLLTPTPKLEKLSLANN 174

  Fly   335 KMLLEVQEGALSGLSQLKHVVLKANALTSLAEGLFPWKDLQTLDLSENPLSCDCRVM----WL-- 393
            . |.|:..|.|:||..|..::|:.|:|.::.:|.|....|....|..||..|:|.::    ||  
Human   175 N-LTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQD 238

  Fly   394 --HNLLVAK-----NASQDDVSELLCE----FP 415
              .|:.|.|     .|...:|:.:.|:    ||
Human   239 NAENVYVWKQGVDVKAMTSNVASVQCDNSDKFP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380
LRR_8 83..142 CDD:290566
leucine-rich repeat 84..107 CDD:275380
leucine-rich repeat 108..131 CDD:275380
LRR_RI 129..421 CDD:238064 82/293 (28%)
LRR_8 132..190 CDD:290566 13/49 (27%)
leucine-rich repeat 132..155 CDD:275380 3/11 (27%)
leucine-rich repeat 156..179 CDD:275380 5/25 (20%)
leucine-rich repeat 180..204 CDD:275380 6/23 (26%)
LRR_8 203..263 CDD:290566 17/59 (29%)
leucine-rich repeat 205..228 CDD:275380 5/22 (23%)
leucine-rich repeat 229..252 CDD:275380 5/22 (23%)
LRR_8 252..308 CDD:290566 19/55 (35%)
leucine-rich repeat 253..276 CDD:275380 10/22 (45%)
leucine-rich repeat 277..300 CDD:275380 7/22 (32%)
leucine-rich repeat 301..322 CDD:275380 6/20 (30%)
LRR_8 325..384 CDD:290566 20/58 (34%)
leucine-rich repeat 326..350 CDD:275380 11/23 (48%)
leucine-rich repeat 351..373 CDD:275380 6/21 (29%)
GP1BANP_000164.5 LRRNT 19..50 CDD:214470 6/33 (18%)
leucine-rich repeat 30..48 CDD:275380 5/20 (25%)
LRR 1 48..68 10/30 (33%)
leucine-rich repeat 49..72 CDD:275380 10/33 (30%)
LRR_RI <51..200 CDD:238064 54/178 (30%)
LRR_8 71..128 CDD:290566 20/73 (27%)
LRR 2 72..93 6/36 (17%)
leucine-rich repeat 73..94 CDD:275380 7/36 (19%)
LRR 3 94..115 9/21 (43%)
leucine-rich repeat 95..117 CDD:275380 10/22 (45%)
LRR_8 116..176 CDD:290566 18/61 (30%)
LRR 4 117..137 5/19 (26%)
leucine-rich repeat 118..141 CDD:275380 7/22 (32%)
LRR 5 141..162 6/21 (29%)
leucine-rich repeat 142..165 CDD:275380 6/23 (26%)
LRR_8 164..222 CDD:290566 19/58 (33%)
LRR 6 165..186 9/21 (43%)
leucine-rich repeat 166..189 CDD:275380 11/23 (48%)
LRR 7 189..210 6/20 (30%)
leucine-rich repeat 190..210 CDD:275380 6/19 (32%)
leucine-rich repeat 213..225 CDD:275378 4/11 (36%)
LRRCT 221..281 CDD:214507 14/51 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 336..459
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.