Sequence 1: | NP_001261796.1 | Gene: | trn / 39491 | FlyBaseID: | FBgn0010452 | Length: | 751 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_000164.5 | Gene: | GP1BA / 2811 | HGNCID: | 4439 | Length: | 652 | Species: | Homo sapiens |
Alignment Length: | 293 | Identity: | 82/293 - (27%) |
---|---|---|---|
Similarity: | 125/293 - (42%) | Gaps: | 53/293 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 143 SELHQGTFTPLLKIE---ELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVIFQAMPS 204
Fly 205 LAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLSDNRLDRIPSV 269
Fly 270 GLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALRLKRVMTGAFSDNGNLEYLNLSSN 334
Fly 335 KMLLEVQEGALSGLSQLKHVVLKANALTSLAEGLFPWKDLQTLDLSENPLSCDCRVM----WL-- 393
Fly 394 --HNLLVAK-----NASQDDVSELLCE----FP 415 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
trn | NP_001261796.1 | leucine-rich repeat | 62..80 | CDD:275380 | |
LRR_8 | 83..142 | CDD:290566 | |||
leucine-rich repeat | 84..107 | CDD:275380 | |||
leucine-rich repeat | 108..131 | CDD:275380 | |||
LRR_RI | 129..421 | CDD:238064 | 82/293 (28%) | ||
LRR_8 | 132..190 | CDD:290566 | 13/49 (27%) | ||
leucine-rich repeat | 132..155 | CDD:275380 | 3/11 (27%) | ||
leucine-rich repeat | 156..179 | CDD:275380 | 5/25 (20%) | ||
leucine-rich repeat | 180..204 | CDD:275380 | 6/23 (26%) | ||
LRR_8 | 203..263 | CDD:290566 | 17/59 (29%) | ||
leucine-rich repeat | 205..228 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 229..252 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 252..308 | CDD:290566 | 19/55 (35%) | ||
leucine-rich repeat | 253..276 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 277..300 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 301..322 | CDD:275380 | 6/20 (30%) | ||
LRR_8 | 325..384 | CDD:290566 | 20/58 (34%) | ||
leucine-rich repeat | 326..350 | CDD:275380 | 11/23 (48%) | ||
leucine-rich repeat | 351..373 | CDD:275380 | 6/21 (29%) | ||
GP1BA | NP_000164.5 | LRRNT | 19..50 | CDD:214470 | 6/33 (18%) |
leucine-rich repeat | 30..48 | CDD:275380 | 5/20 (25%) | ||
LRR 1 | 48..68 | 10/30 (33%) | |||
leucine-rich repeat | 49..72 | CDD:275380 | 10/33 (30%) | ||
LRR_RI | <51..200 | CDD:238064 | 54/178 (30%) | ||
LRR_8 | 71..128 | CDD:290566 | 20/73 (27%) | ||
LRR 2 | 72..93 | 6/36 (17%) | |||
leucine-rich repeat | 73..94 | CDD:275380 | 7/36 (19%) | ||
LRR 3 | 94..115 | 9/21 (43%) | |||
leucine-rich repeat | 95..117 | CDD:275380 | 10/22 (45%) | ||
LRR_8 | 116..176 | CDD:290566 | 18/61 (30%) | ||
LRR 4 | 117..137 | 5/19 (26%) | |||
leucine-rich repeat | 118..141 | CDD:275380 | 7/22 (32%) | ||
LRR 5 | 141..162 | 6/21 (29%) | |||
leucine-rich repeat | 142..165 | CDD:275380 | 6/23 (26%) | ||
LRR_8 | 164..222 | CDD:290566 | 19/58 (33%) | ||
LRR 6 | 165..186 | 9/21 (43%) | |||
leucine-rich repeat | 166..189 | CDD:275380 | 11/23 (48%) | ||
LRR 7 | 189..210 | 6/20 (30%) | |||
leucine-rich repeat | 190..210 | CDD:275380 | 6/19 (32%) | ||
leucine-rich repeat | 213..225 | CDD:275378 | 4/11 (36%) | ||
LRRCT | 221..281 | CDD:214507 | 14/51 (27%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 336..459 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24373 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |