DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and Elfn1

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001371115.1 Gene:Elfn1 / 243312 MGIID:2442479 Length:828 Species:Mus musculus


Alignment Length:770 Identity:167/770 - (21%)
Similarity:248/770 - (32%) Gaps:266/770 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 IPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLRGNQISELHQGTFTPLLKIEELNL 161
            |||:   ....:.::.||.|:|..:...:......:|.|||..|:|..:..|.|:....::.|.|
Mouse    54 IPQQ---INNTIVDLRLNENRIRSVQYASLSRFGNLTYLNLTKNEIGYIEDGAFSGQFNLQVLQL 115

  Fly   162 GENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVIFQAMPSLAELFLGMNTLQSIQADAFQDL 226
            |.||:..|......|||:|..|||..|.:..|.....::. |::..:.|.||.:|.:.:..|   
Mouse   116 GYNRLRNLTEGMLRGLSKLEYLYLQANLIEVVMASAFWEC-PNIVNIDLSMNRIQQLGSGTF--- 176

  Fly   227 KGLTRL--------------ELKG-----ASLRNI--SHDS------------FLGLQELRILDL 258
            .|||:|              ||.|     |:..|.  :||.            ||         |
Mouse   177 AGLTKLSVCEIYSNPFYCSCELLGFLRWLAAFTNATQTHDRVQCESPPVYAGYFL---------L 232

  Fly   259 SDNRLDRIPSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALR--LKRVMTG--- 318
            ...|.....|: ||||.            .|.:||::..       ||.|..|  ..|...|   
Mouse   233 GQGRHGHQRSI-LSKLQ------------SVCTEGSYTA-------EVLGPPRPVPGRSQPGHSP 277

  Fly   319 ----------------AFSDNGNLEYLNLSSNKMLLEVQEGALSGLSQLKHVVLKANALTSLAEG 367
                            .||.:|....:.|::   |:...|...|    :|...|..|:.|.:.:.
Mouse   278 PPPPPEPSDMPCADDECFSGDGTTPLVILTT---LVPQTEARPS----MKVKQLTQNSATIMVQL 335

  Fly   368 LFPWKDLQTLDLSENPLSCDCRVMW-------LHNLLVAKNASQDDVSE-----------LLC-E 413
            ..|:..:.||:...|..|.....:.       |.||....|.:...||.           .:| .
Mouse   336 PSPFNRMYTLEQYNNSKSFTVSKLTQPQEEIRLTNLYTLTNYTYCVVSTSSGTHHNHTCLTICLP 400

  Fly   414 FPERLRG-----ESLRHLNPAMMGCTHADPRKQALIGALLVGSAATITALALVLYRCRHKIRETI 473
            .|....|     .:..|....::||         |.|.:||        |..|.|..|.:.|:..
Mouse   401 KPPSPPGPVPSPSTATHYIMTILGC---------LFGMVLV--------LGAVYYCLRKRRRQEE 448

  Fly   474 KGGLWGNSALGRKEREYQKTFCDEDY--------MSRHQHHPCSLGIHSTFPNTYT-APHHPGAT 529
            |    ...|:.......:||..:..|        ::.....|. ||     |...| .|:.|.||
Mouse   449 K----HKKAVAAAAGSLKKTIIELKYGPEIEAPGLAPLTQGPL-LG-----PEAVTRIPYLPAAT 503

  Fly   530 ---HHYGM-----CPMPVN----DLGAIDPQQKF----------QQLVVPTATMISE----KKLN 568
               ..|.:     .|....    ::...:||::.          |..|...:|:..|    .::.
Mouse   504 SDVEQYKLVESSETPKATKGNYIEVRTGEPQERRGCELSRPGEPQSSVAEISTIAKEVDRVNQII 568

  Fly   569 NN--KALVSQGAIDDSASFVLHMKSATMGRDVHQQNPQLNHYTKP-----QFLS----------- 615
            ||  .||.|     :|.||    :.|..|. |....|||...::|     .|||           
Mouse   569 NNCIDALKS-----ESTSF----QGAKSGA-VSAAEPQLVLLSEPLASKHSFLSPVYKDAFGHGG 623

  Fly   616 ---------------ATATVGDSCYS----YADVPMVHGAPL--------GGPNQPQLRLT---- 649
                           |:.:...|..|    .|:....|.||.        ..| .|:..||    
Mouse   624 LQRHHSVEAAPGPPRASTSSSGSARSPRTFRAEATGTHKAPATETKYIEKSSP-VPETILTVTPA 687

  Fly   650 -----QEHFKQRELYDQEMGSEILDHNYIYSNTHYSMPLEQLGRSKTPTPPPMPP 699
                 .|..|.|: |.        :|.:.|..:|.:.|         |.|||.||
Mouse   688 ATVLRAEADKSRQ-YG--------EHRHSYPGSHPAEP---------PAPPPPPP 724

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380
LRR_8 83..142 CDD:290566 12/44 (27%)
leucine-rich repeat 84..107 CDD:275380 3/9 (33%)
leucine-rich repeat 108..131 CDD:275380 4/22 (18%)
LRR_RI 129..421 CDD:238064 83/369 (22%)
LRR_8 132..190 CDD:290566 22/57 (39%)
leucine-rich repeat 132..155 CDD:275380 8/22 (36%)
leucine-rich repeat 156..179 CDD:275380 8/22 (36%)
leucine-rich repeat 180..204 CDD:275380 6/23 (26%)
LRR_8 203..263 CDD:290566 20/92 (22%)
leucine-rich repeat 205..228 CDD:275380 5/22 (23%)
leucine-rich repeat 229..252 CDD:275380 12/55 (22%)
LRR_8 252..308 CDD:290566 12/55 (22%)
leucine-rich repeat 253..276 CDD:275380 7/22 (32%)
leucine-rich repeat 277..300 CDD:275380 3/22 (14%)
leucine-rich repeat 301..322 CDD:275380 7/41 (17%)
LRR_8 325..384 CDD:290566 12/58 (21%)
leucine-rich repeat 326..350 CDD:275380 4/23 (17%)
leucine-rich repeat 351..373 CDD:275380 5/21 (24%)
Elfn1NP_001371115.1 LRR 1 61..82 4/20 (20%)
leucine-rich repeat 65..85 CDD:275378 4/19 (21%)
LRR_8 85..144 CDD:404697 22/58 (38%)
LRR 2 85..106 8/20 (40%)
leucine-rich repeat 86..109 CDD:275378 8/22 (36%)
LRR 3 109..130 6/20 (30%)
leucine-rich repeat 110..133 CDD:275378 8/22 (36%)
LRR_8 132..182 CDD:404697 16/53 (30%)
LRR 4 133..154 6/20 (30%)
leucine-rich repeat 134..157 CDD:275378 6/23 (26%)
LRR 5 157..178 5/23 (22%)
leucine-rich repeat 158..171 CDD:275378 4/12 (33%)
LRRCT 190..>228 CDD:214507 7/37 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..293 6/41 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 627..674 7/46 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 697..731 13/46 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.