DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and Lrrc26

DIOPT Version :10

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_666229.1 Gene:Lrrc26 / 227618 MGIID:2385129 Length:331 Species:Mus musculus


Alignment Length:211 Identity:52/211 - (24%)
Similarity:87/211 - (41%) Gaps:28/211 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MMIAFVGIWCILASIGVEPAAG--LANCPPGCQCDDNTLVVQCGEGQLDVLPIALNPSIQRLVIK 67
            ::::...:| ....||..|:..  ...||..|.|.... ...|....|..:|..|:..::.|::.
Mouse    17 LLLSLRRVW-TQEDIGTAPSKSPVAPECPEACSCSLGG-KANCSALALPAVPADLSWQVRSLLLD 79

  Fly    68 SNKIKTIDSSIQFYAELTFLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAV 132
            .|::.                       .:|...||....|..:.|..|::..:..:.|.||..:
Mouse    80 HNRVS-----------------------ALPPGAFANAGALLYLDLRENRLRSVHARAFWGLGVL 121

  Fly   133 TVLNLRGNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPV 197
            ..|:|..||:..|..|||.||..:..|:|..||:..|:|.....|..||:|.|.||:|:.: :..
Mouse   122 QWLDLSSNQLETLPPGTFAPLRALSFLSLAGNRLALLEPSILGPLPLLRVLSLQDNSLSAI-EAG 185

  Fly   198 IFQAMPSLAELFLGMN 213
            :...:|:|..|.|..|
Mouse   186 LLNNLPALDVLRLHGN 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 2/17 (12%)
LRR 82..406 CDD:443914 38/132 (29%)
leucine-rich repeat 84..107 CDD:275380 3/22 (14%)
leucine-rich repeat 108..131 CDD:275380 6/22 (27%)
leucine-rich repeat 132..155 CDD:275380 10/22 (45%)
leucine-rich repeat 156..179 CDD:275380 7/22 (32%)
leucine-rich repeat 180..204 CDD:275380 7/23 (30%)
leucine-rich repeat 205..228 CDD:275380 4/9 (44%)
leucine-rich repeat 229..252 CDD:275380
leucine-rich repeat 253..276 CDD:275380
leucine-rich repeat 277..300 CDD:275380
leucine-rich repeat 301..322 CDD:275380
leucine-rich repeat 326..350 CDD:275380
leucine-rich repeat 351..373 CDD:275380
LRRCT 382..434 CDD:214507
Lrrc26NP_666229.1 LRR <62..>201 CDD:443914 42/162 (26%)
LRR 1 72..93 4/43 (9%)
leucine-rich repeat 73..96 CDD:275380 5/45 (11%)
LRR 2 96..117 4/20 (20%)
leucine-rich repeat 97..120 CDD:275380 6/22 (27%)
LRR 3 120..141 8/20 (40%)
leucine-rich repeat 121..144 CDD:275380 10/22 (45%)
LRR 4 144..165 6/20 (30%)
leucine-rich repeat 145..168 CDD:275380 7/22 (32%)
LRR 5 168..191 7/23 (30%)
leucine-rich repeat 169..192 CDD:275380 7/23 (30%)
PCC 174..>267 CDD:188093 9/29 (31%)
leucine-rich repeat 236..255 CDD:275380
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 310..331
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.