| Sequence 1: | NP_001261796.1 | Gene: | trn / 39491 | FlyBaseID: | FBgn0010452 | Length: | 751 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_666164.1 | Gene: | Lrrc3b / 218763 | MGIID: | 2384996 | Length: | 259 | Species: | Mus musculus |
| Alignment Length: | 204 | Identity: | 43/204 - (21%) |
|---|---|---|---|
| Similarity: | 61/204 - (29%) | Gaps: | 96/204 - (47%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 30 CPPGCQCDDN-TLVVQCGEGQLDVLPIALNPSIQRLVIKSNKIKTIDSSIQFYAELTFLDLSSNH 93
Fly 94 LMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLRGNQISELHQGTFTPLLKIEE 158
Fly 159 LNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVIFQAMPSLAELFLGMNTLQSIQADAF 223
Fly 224 QDLKGLTRL 232 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| trn | NP_001261796.1 | leucine-rich repeat | 62..80 | CDD:275380 | 0/17 (0%) |
| LRR_8 | 83..142 | CDD:290566 | 8/58 (14%) | ||
| leucine-rich repeat | 84..107 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 108..131 | CDD:275380 | 0/22 (0%) | ||
| LRR_RI | 129..421 | CDD:238064 | 23/104 (22%) | ||
| LRR_8 | 132..190 | CDD:290566 | 12/57 (21%) | ||
| leucine-rich repeat | 132..155 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 156..179 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 180..204 | CDD:275380 | 0/23 (0%) | ||
| LRR_8 | 203..263 | CDD:290566 | 11/30 (37%) | ||
| leucine-rich repeat | 205..228 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 229..252 | CDD:275380 | 1/4 (25%) | ||
| LRR_8 | 252..308 | CDD:290566 | |||
| leucine-rich repeat | 253..276 | CDD:275380 | |||
| leucine-rich repeat | 277..300 | CDD:275380 | |||
| leucine-rich repeat | 301..322 | CDD:275380 | |||
| LRR_8 | 325..384 | CDD:290566 | |||
| leucine-rich repeat | 326..350 | CDD:275380 | |||
| leucine-rich repeat | 351..373 | CDD:275380 | |||
| Lrrc3b | NP_666164.1 | LRRNT | 33..68 | CDD:214470 | 13/56 (23%) |
| LRR 1 | 65..86 | 8/60 (13%) | |||
| leucine-rich repeat | 66..89 | CDD:275378 | 8/62 (13%) | ||
| LRR_8 | 69..125 | CDD:404697 | 23/127 (18%) | ||
| LRR 2 | 89..110 | 9/28 (32%) | |||
| leucine-rich repeat | 90..113 | CDD:275378 | 9/22 (41%) | ||
| LRR 3 | 114..135 | 8/20 (40%) | |||
| leucine-rich repeat | 115..138 | CDD:275378 | 9/22 (41%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24373 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||