DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment trn and Lrrc3c

DIOPT Version :9

Sequence 1:	NP_001261796.1	Gene:	trn / 39491	FlyBaseID:	FBgn0010452	Length:	751	Species:	Drosophila melanogaster
Sequence 2:	NP_001182473.1	Gene:	Lrrc3c / 192852	MGIID:	2684858	Length:	255	Species:	Mus musculus

Alignment Length:	119	Identity:	43/119 - (36%)
Similarity:	63/119 - (52%)	Gaps:	18/119 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   176 GLSQL--------RILYLDDNALTTVPDPVIFQAMPSLAELFLGMNTLQSIQADAFQDLKG-LTR 231
            |||.:        |.||||.|.|.:||... ||.:|:|.||.|..|.|..:...|||.|:| |..
Mouse    48 GLSAVPNGIPNDTRKLYLDANQLASVPAGA-FQHLPALEELDLSHNALVHLSGAAFQGLEGTLRH 111

  Fly   232 LELKGASLRNISHDSFLGLQELRILDLSDN--RLDRIPSVGLSKLVRLEQLSLG 283
            |:|....|.::...:|:||| ::: :||.|  |.|    ..|.:::|..:|:.|
Mouse   112 LDLSANQLASVPVAAFVGLQ-IQV-NLSANPWRCD----CALQEVLRHVRLAPG 159

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
trn	NP_001261796.1	leucine-rich repeat	62..80	CDD:275380
		LRR_8	83..142	CDD:290566
		leucine-rich repeat	84..107	CDD:275380
		leucine-rich repeat	108..131	CDD:275380
		LRR_RI	129..421	CDD:238064	43/119 (36%)
		LRR_8	132..190	CDD:290566	9/21 (43%)
		leucine-rich repeat	132..155	CDD:275380
		leucine-rich repeat	156..179	CDD:275380	2/2 (100%)
		leucine-rich repeat	180..204	CDD:275380	11/31 (35%)
		LRR_8	203..263	CDD:290566	23/62 (37%)
		leucine-rich repeat	205..228	CDD:275380	10/22 (45%)
		leucine-rich repeat	229..252	CDD:275380	7/22 (32%)
		LRR_8	252..308	CDD:290566	9/34 (26%)
		leucine-rich repeat	253..276	CDD:275380	6/24 (25%)
		leucine-rich repeat	277..300	CDD:275380	2/7 (29%)
		leucine-rich repeat	301..322	CDD:275380
		LRR_8	325..384	CDD:290566
		leucine-rich repeat	326..350	CDD:275380
		leucine-rich repeat	351..373	CDD:275380
Lrrc3c	NP_001182473.1	leucine-rich repeat	40..59	CDD:275378	3/10 (30%)
		leucine-rich repeat	60..83	CDD:275378	11/23 (48%)
		LRR_8	61..119	CDD:290566	26/58 (45%)
		LRR_4	61..99	CDD:289563	18/38 (47%)
		LRR_4	82..123	CDD:289563	16/40 (40%)
		leucine-rich repeat	84..108	CDD:275378	10/23 (43%)
		leucine-rich repeat	109..131	CDD:275378	6/21 (29%)
		leucine-rich repeat	132..143	CDD:275378	3/11 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24373
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100