DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and let-4

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_510425.2 Gene:let-4 / 181554 WormBaseID:WBGene00002282 Length:773 Species:Caenorhabditis elegans


Alignment Length:400 Identity:115/400 - (28%)
Similarity:189/400 - (47%) Gaps:29/400 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NCPPG-----CQCDD--NTLVVQCGEGQLD-VLPIALNPSIQRLVIKS---NKIKTIDSSIQFYA 82
            |..||     |.|.:  :.:|:.|...... :|.|......|..:|:|   |:.:.::....|::
 Worm    19 NACPGVITQACFCSEVHSGIVLDCSNSSASGILQIIRTNQAQVGLIQSLTMNQAELVELPPNFFS 83

  Fly    83 ELTF--LDLSSNHLMTIPQRTFA-YQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLRGNQISE 144
            .|..  ||||.|.:..|....|| ....|:||.||||.|.::......||..:..|:|..|.|.|
 Worm    84 GLFIRRLDLSQNKIKKIDDAAFAGINPVLEEVVLNHNLIEKVPAAALAGLPNLLRLDLSNNSIVE 148

  Fly   145 L-HQGTFTPLLKIEELNLGENRIGYLDPKAFDGL-SQLRILYLDDNALTTVPDPVIFQAMPSLAE 207
            : .|..|..|.|:.::|||.|:|..:....|..: :.::.:.|..|.:|.||...| :.:..|..
 Worm   149 IQEQEIFPNLNKLYDINLGSNKIFSIHTSTFQNVKNSIQTINLGHNNMTAVPSSAI-RGLKQLQS 212

  Fly   208 LFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLSDNRLDRIPSVGLS 272
            |.|..|.::.:.|..|.:|..|..|.|.|..:..::..:||.:..||.|.||.|::.::.:....
 Worm   213 LHLHKNRIEQLDALNFLNLPVLNLLNLAGNQIHELNRQAFLNVPSLRYLYLSGNKITKLTAYQFQ 277

  Fly   273 KLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALRLKRVMTGAFSDNGNLEYLNLSSNKML 337
            ...:||.|.|..|:...|...:..|||||::|.: ...::..:.:.||: |.::..|.||||: |
 Worm   278 TFEQLEMLDLTNNEIGAIPANSLSGLKQLRQLYL-AHNKISNISSNAFT-NSSIVVLVLSSNE-L 339

  Fly   338 LEVQEGALSGLSQLKHVVLKANALTSLAEGLF-PWKDLQTLDLSENPLSCDCRVMWLH--NLLVA 399
            ..:..|.:|||..|:.|..:.|.:.::....| ....|..|||::|.|:......:|.  |||:.
 Worm   340 KTLTAGIISGLPNLQQVSFRDNQIKTINRNAFYDAASLVMLDLAKNQLTEIAPTTFLAQLNLLLV 404

  Fly   400 KNASQDDVSE 409
                  |:||
 Worm   405 ------DLSE 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 4/20 (20%)
LRR_8 83..142 CDD:290566 22/61 (36%)
leucine-rich repeat 84..107 CDD:275380 9/25 (36%)
leucine-rich repeat 108..131 CDD:275380 10/22 (45%)
LRR_RI 129..421 CDD:238064 82/285 (29%)
LRR_8 132..190 CDD:290566 17/59 (29%)
leucine-rich repeat 132..155 CDD:275380 8/23 (35%)
leucine-rich repeat 156..179 CDD:275380 6/23 (26%)
leucine-rich repeat 180..204 CDD:275380 6/23 (26%)
LRR_8 203..263 CDD:290566 19/59 (32%)
leucine-rich repeat 205..228 CDD:275380 7/22 (32%)
leucine-rich repeat 229..252 CDD:275380 6/22 (27%)
LRR_8 252..308 CDD:290566 18/55 (33%)
leucine-rich repeat 253..276 CDD:275380 6/22 (27%)
leucine-rich repeat 277..300 CDD:275380 8/22 (36%)
leucine-rich repeat 301..322 CDD:275380 4/20 (20%)
LRR_8 325..384 CDD:290566 19/59 (32%)
leucine-rich repeat 326..350 CDD:275380 10/23 (43%)
leucine-rich repeat 351..373 CDD:275380 4/22 (18%)
let-4NP_510425.2 leucine-rich repeat 66..86 CDD:275380 3/19 (16%)
LRR_RI <71..275 CDD:238064 60/204 (29%)
LRR_8 88..146 CDD:290566 21/57 (37%)
leucine-rich repeat 88..111 CDD:275380 8/22 (36%)
leucine-rich repeat 112..135 CDD:275380 10/22 (45%)
leucine-rich repeat 136..160 CDD:275380 8/23 (35%)
LRR_8 156..220 CDD:290566 18/64 (28%)
leucine-rich repeat 161..184 CDD:275380 6/22 (27%)
leucine-rich repeat 186..209 CDD:275380 6/23 (26%)
leucine-rich repeat 210..257 CDD:275380 13/46 (28%)
LRR_RI <250..411 CDD:238064 49/167 (29%)
LRR_8 256..316 CDD:290566 18/60 (30%)
leucine-rich repeat 258..281 CDD:275380 6/22 (27%)
leucine-rich repeat 282..305 CDD:275380 8/22 (36%)
leucine-rich repeat 306..328 CDD:275380 5/23 (22%)
LRR_8 327..387 CDD:290566 19/60 (32%)
leucine-rich repeat 329..350 CDD:275380 8/21 (38%)
leucine-rich repeat 353..400 CDD:275380 11/46 (24%)
leucine-rich repeat 356..376 CDD:275380 3/19 (16%)
leucine-rich repeat 401..419 CDD:275380 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BG7P
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.