DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and lron-2

DIOPT Version :10

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_505402.1 Gene:lron-2 / 179309 WormBaseID:WBGene00022789 Length:575 Species:Caenorhabditis elegans


Alignment Length:56 Identity:18/56 - (32%)
Similarity:24/56 - (42%) Gaps:13/56 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CLLPSFASY----------PSSPSYSSSRQVSSVSRRFRPV-LASRPVSKNS--PY 74
            |:.|:|||.          |||........:||.:....|: .||..|.|:|  ||
 Worm    23 CIKPTFASIFNFFSKKPKRPSSTYRHCHSSISSATPSSTPLATASVAVEKDSDDPY 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 7/16 (44%)
LRR 82..406 CDD:443914
leucine-rich repeat 84..107 CDD:275380
leucine-rich repeat 108..131 CDD:275380
leucine-rich repeat 132..155 CDD:275380
leucine-rich repeat 156..179 CDD:275380
leucine-rich repeat 180..204 CDD:275380
leucine-rich repeat 205..228 CDD:275380
leucine-rich repeat 229..252 CDD:275380
leucine-rich repeat 253..276 CDD:275380
leucine-rich repeat 277..300 CDD:275380
leucine-rich repeat 301..322 CDD:275380
leucine-rich repeat 326..350 CDD:275380
leucine-rich repeat 351..373 CDD:275380
LRRCT 382..434 CDD:214507
lron-2NP_505402.1 LRR 59..441 CDD:443914 8/20 (40%)
leucine-rich repeat 64..84 CDD:275380 7/15 (47%)
leucine-rich repeat 85..109 CDD:275380
leucine-rich repeat 110..133 CDD:275380
leucine-rich repeat 134..157 CDD:275380
leucine-rich repeat 161..187 CDD:275380
leucine-rich repeat 188..211 CDD:275380
leucine-rich repeat 213..235 CDD:275380
leucine-rich repeat 236..259 CDD:275380
leucine-rich repeat 260..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..355 CDD:275380
leucine-rich repeat 356..377 CDD:275380
leucine-rich repeat 380..400 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.