DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and tol-1

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001020983.1 Gene:tol-1 / 171635 WormBaseID:WBGene00006593 Length:1221 Species:Caenorhabditis elegans


Alignment Length:777 Identity:167/777 - (21%)
Similarity:288/777 - (37%) Gaps:223/777 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SIQRLVIKSNKIKTIDSSIQFYAELTFLDLSSNHLMTIP----QRTFAYQKKLQEVHLNHNKIGQ 120
            |:..|.:..|:|:..:||:....||..||.|.|.|.::|    |:.   :|::..:||.||.|.|
 Worm   283 SLVALNVSRNEIEAGNSSVFSSPELEMLDASYNKLDSLPVEWLQKC---EKRIAHLHLEHNSIEQ 344

  Fly   121 ISNKTFIGLSAVTVLNLRGNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYL 185
            ::.......:.:..|:|..||:............||..|.|..|.:..|:|.:..|| :|..|.|
 Worm   345 LTGGVLANATNLQTLDLSSNQLRVFRDEVLPENSKIGNLRLSNNSLELLEPSSLSGL-KLESLDL 408

  Fly   186 DDNALTTVPDPVIFQAMPSLAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGL 250
            ..|.||.||..:  ..:..|.::.|..|.:..:.......:|.|..::|....|::|....|...
 Worm   409 SHNKLTEVPAAI--GKVEQLKKVDLSHNRIAKVYQYVLNKIKQLHTVDLSNNQLQSIGPYIFSDS 471

  Fly   251 QELRILDLSDNRLDRIPSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEV--NGALRLK 313
            .||..||:|:|.:..:.....::..:|.::|:..|..:.:.|| ......|:||:|  |..|.||
 Worm   472 SELHSLDVSNNEISLLFKDAFARCPKLRKISMKMNKIKSLDEG-LTEASGLRRLDVSHNEILVLK 535

  Fly   314 ------------------RVMTGA-------------FSDNG-----------NLEYLNLSSNKM 336
                              .::|.|             .|:||           :||.|::|:|: 
 Worm   536 WSALPENLEILNADNNDINLLTAASMSPSTANLKSVSLSNNGITIMNADQIPNSLESLDVSNNR- 599

  Fly   337 LLEVQEGALSGLSQLKHVVLKANALTSLA-------EGLFPWKDLQTLDLSENPLSCDCRVMWL- 393
            |.::.:.||:..|||:.:.||.|.||.:|       |.:.|.|    :::|||||.|||::.|: 
 Worm   600 LAKLGKTALAAKSQLRRLNLKGNLLTVVATESMKVVEAVHPLK----VEISENPLICDCQMGWMI 660

  Fly   394 -----------------------HNLLVAKNASQDDVSELLCEFPERLRGESL---------RHL 426
                                   |.:.:...:.:|    |||.:......|.:         :.:
 Worm   661 GGAKPKVLIQDSETASCSHAVDGHQIQIQSLSKKD----LLCPYKSVCEPECICCQYGNCDCKSV 721

  Fly   427 NPAMMGCTHAD----------------PRKQALIGALLVGSAATITALALVLYRCRHKIRETIKG 475
            .||...|...|                |:::.::..|.| ||..|....:.|.:.|         
 Worm   722 CPANCRCFRDDQFNINIVRCHGNSSMVPKREFVVSELPV-SATEIILSGVTLPQLR--------- 776

  Fly   476 GLWGNSALGRKEREYQKTFCDEDYMSRHQHHPCSLGIHSTFPNTY-TAPHHPGATHHYGMCPMPV 539
               .:|.:||              :...:.|....|:.|..|..: |.|         .:..:.:
 Worm   777 ---THSFIGR--------------LRLQRLHINGTGLRSIQPKAFHTLP---------ALKTLDL 815

  Fly   540 NDLGAID-PQQKFQQLVVPTATMISEKKLNNNKALVSQGAIDDSASFVLHMKSATMGRDVHQQNP 603
            :|...|. ..::|.:     ...:|:..||.|                   :.:|:.|.:.::.|
 Worm   816 SDNSLISLSGEEFLK-----CGEVSQLFLNGN-------------------RFSTLSRGIFEKLP 856

  Fly   604 QLNHYTK--------PQFLSATATVGDSCYSYADVPMVHGAPLGGPNQ-------PQLRLTQEH- 652
            .|.:.|.        ||.|.:||.   |..|.:..|:..... ||..|       |:.....|| 
 Worm   857 NLKYLTLHNNSLEDIPQVLHSTAL---SKISLSSNPLRCDCS-GGSQQHLHHRRDPKAHPFWEHN 917

  Fly   653 --------------FKQRELYDQEMGSEILDHNYIYS-------NTHYSMPLEQLGRSKTPT 693
                          |.:.|.::....:.:.:...:.|       |..:.||:|:..|....|
 Worm   918 AAEWFSLHRHLVVDFPKVECWENVTKAFLTNDTTVLSAYPPNMGNDVFVMPIEEFLRDYNST 979

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 5/17 (29%)
LRR_8 83..142 CDD:290566 19/62 (31%)
leucine-rich repeat 84..107 CDD:275380 8/26 (31%)
leucine-rich repeat 108..131 CDD:275380 6/22 (27%)
LRR_RI 129..421 CDD:238064 88/366 (24%)
LRR_8 132..190 CDD:290566 17/57 (30%)
leucine-rich repeat 132..155 CDD:275380 4/22 (18%)
leucine-rich repeat 156..179 CDD:275380 8/22 (36%)
leucine-rich repeat 180..204 CDD:275380 8/23 (35%)
LRR_8 203..263 CDD:290566 15/59 (25%)
leucine-rich repeat 205..228 CDD:275380 3/22 (14%)
leucine-rich repeat 229..252 CDD:275380 5/22 (23%)
LRR_8 252..308 CDD:290566 15/57 (26%)
leucine-rich repeat 253..276 CDD:275380 5/22 (23%)
leucine-rich repeat 277..300 CDD:275380 5/22 (23%)
leucine-rich repeat 301..322 CDD:275380 10/53 (19%)
LRR_8 325..384 CDD:290566 23/65 (35%)
leucine-rich repeat 326..350 CDD:275380 8/23 (35%)
leucine-rich repeat 351..373 CDD:275380 9/28 (32%)
tol-1NP_001020983.1 leucine-rich repeat 71..95 CDD:275380
leucine-rich repeat 96..119 CDD:275380
leucine-rich repeat 120..171 CDD:275380
leucine-rich repeat 172..195 CDD:275380
leucine-rich repeat 196..283 CDD:275380 167/777 (21%)
leucine-rich repeat 219..240 CDD:275378
leucine-rich repeat 241..258 CDD:275378
LRR 265..600 CDD:227223 81/324 (25%)
leucine-rich repeat 287..306 CDD:275380 5/18 (28%)
leucine-rich repeat 307..331 CDD:275380 8/26 (31%)
leucine-rich repeat 332..355 CDD:275380 6/22 (27%)
leucine-rich repeat 356..379 CDD:275380 4/22 (18%)
leucine-rich repeat 380..395 CDD:275380 5/14 (36%)
leucine-rich repeat 403..425 CDD:275380 8/23 (35%)
leucine-rich repeat 426..449 CDD:275380 3/22 (14%)
leucine-rich repeat 450..473 CDD:275380 5/22 (23%)
leucine-rich repeat 474..497 CDD:275380 5/22 (23%)
leucine-rich repeat 498..520 CDD:275380 5/22 (23%)
leucine-rich repeat 543..567 CDD:275380 2/23 (9%)
leucine-rich repeat 568..589 CDD:275380 3/20 (15%)
leucine-rich repeat 590..613 CDD:275380 8/23 (35%)
leucine-rich repeat 614..633 CDD:275380 7/18 (39%)
leucine-rich repeat 763..785 CDD:275378 6/47 (13%)
LRR_8 785..844 CDD:338972 13/91 (14%)
leucine-rich repeat 786..809 CDD:275378 6/31 (19%)
LRR_9 <806..>890 CDD:373143 21/119 (18%)
leucine-rich repeat 810..833 CDD:275378 3/27 (11%)
leucine-rich repeat 834..857 CDD:275378 6/41 (15%)
leucine-rich repeat 858..879 CDD:275378 5/20 (25%)
leucine-rich repeat 880..892 CDD:275378 3/14 (21%)
TIR_2 1056..1194 CDD:390066
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.