DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and LRG1

DIOPT Version :10

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_443204.1 Gene:LRG1 / 116844 HGNCID:29480 Length:347 Species:Homo sapiens


Alignment Length:299 Identity:92/299 - (30%)
Similarity:136/299 - (45%) Gaps:38/299 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 AVTVLNLRGNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPD 195
            ||...||. :..:.|.||.    .|::||:|..|.:..|.|:....:.|||:|.|..||||.:| 
Human    74 AVEFFNLT-HLPANLLQGA----SKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLP- 132

  Fly   196 PVIFQAMPSLAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLSD 260
            |.:|||..:|..|.|..|.|:.::......||.|..|:|.|..||.:..........||.|||.:
Human   133 PGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGE 197

  Fly   261 NRLDRIPSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALRLKRVMTGAFSDNGN 325
            |:|:.:|...|...::||:|.|..|..:|:.:...:                         ...:
Human   198 NQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLL-------------------------PQPD 237

  Fly   326 LEYLNLSSNKMLLEVQEGALSGLSQLKHVVLKANALTSLAEGLFP------WKDLQTLDLSENPL 384
            |.||.|:.|| |..|..||..||.||..:.|..|:|.|:.|||:.      |......|:|.||.
Human   238 LRYLFLNGNK-LARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPW 301

  Fly   385 SCDCRVMWLHNLLVAKNASQDDVSELLCEFPERLRGESL 423
            .||..:..|:..|.|:.......::..|..||.::|::|
Human   302 ICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380
LRR 82..406 CDD:443914 87/280 (31%)
leucine-rich repeat 84..107 CDD:275380
leucine-rich repeat 108..131 CDD:275380 92/299 (31%)
leucine-rich repeat 132..155 CDD:275380 6/22 (27%)
leucine-rich repeat 156..179 CDD:275380 6/22 (27%)
leucine-rich repeat 180..204 CDD:275380 13/23 (57%)
leucine-rich repeat 205..228 CDD:275380 6/22 (27%)
leucine-rich repeat 229..252 CDD:275380 6/22 (27%)
leucine-rich repeat 253..276 CDD:275380 9/22 (41%)
leucine-rich repeat 277..300 CDD:275380 6/22 (27%)
leucine-rich repeat 301..322 CDD:275380 0/20 (0%)
leucine-rich repeat 326..350 CDD:275380 12/23 (52%)
leucine-rich repeat 351..373 CDD:275380 9/27 (33%)
LRRCT 382..434 CDD:214507 12/42 (29%)
LRG1NP_443204.1 LRR <79..319 CDD:443914 85/271 (31%)
LRR 1 93..114 7/20 (35%)
leucine-rich repeat 94..117 CDD:275380 6/22 (27%)
LRR 2 117..138 12/21 (57%)
leucine-rich repeat 118..141 CDD:275380 13/23 (57%)
LRR 3 141..162 5/20 (25%)
leucine-rich repeat 142..165 CDD:275380 6/22 (27%)
LRR 4 165..186 6/20 (30%)
leucine-rich repeat 166..189 CDD:275380 6/22 (27%)
LRR 5 189..210 9/20 (45%)
leucine-rich repeat 190..213 CDD:275380 9/22 (41%)
LRR 6 213..234 6/45 (13%)
leucine-rich repeat 214..237 CDD:275380 6/47 (13%)
LRR 7 237..258 10/21 (48%)
leucine-rich repeat 238..261 CDD:275380 12/23 (52%)
LRR 8 261..282 9/20 (45%)
leucine-rich repeat 262..285 CDD:275380 8/22 (36%)
LRRCT 299..346 CDD:214507 12/42 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.