DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and VASN

DIOPT Version :10

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_612449.2 Gene:VASN / 114990 HGNCID:18517 Length:673 Species:Homo sapiens


Alignment Length:423 Identity:114/423 - (26%)
Similarity:172/423 - (40%) Gaps:90/423 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ILASIGVEPAAGLANCPPGCQCDDNTLVVQCGEGQLDVLPIALNPSIQRLVIKSNKIKTIDS-SI 78
            :|.::|    .|:..||.||||.....|. |...|...:|..:.|....|.:..|.|..:|: |.
Human    13 LLLALG----PGVQGCPSGCQCSQPQTVF-CTARQGTTVPRDVPPDTVGLYVFENGITMLDAGSF 72

  Fly    79 QFYAELTFLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLRGNQIS 143
            .....|..||||.|.:.::|...|.....|..:.|..|::.:|:|:||.||.             
Human    73 AGLPGLQLLDLSQNQIASLPSGVFQPLANLSNLDLTANRLHEITNETFRGLR------------- 124

  Fly   144 ELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVIFQAMPSLAEL 208
                       ::|.|.||:|||.::.|.|||.|.:|..|.|.||.|..:| |:   .:|.|..|
Human   125 -----------RLERLYLGKNRIRHIQPGAFDTLDRLLELKLQDNELRALP-PL---RLPRLLLL 174

  Fly   209 FLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLSDNRLDRIPSVGLSK 273
            .|..|:|.::: ....|...:..|.|.|..|:.:....|..|:.|..||:|||:|:|:|.|    
Human   175 DLSHNSLLALE-PGILDTANVEALRLAGLGLQQLDEGLFSRLRNLHDLDVSDNQLERVPPV---- 234

  Fly   274 LVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALRLKRVMTGAFSDNGNLEYLNLSSNKMLL 338
                                 ..||:.|.|                         |.|:.|..:.
Human   235 ---------------------IRGLRGLTR-------------------------LRLAGNTRIA 253

  Fly   339 EVQEGALSGLSQLKHV---VLKANALTSLAEGLFPWKDLQTLDLSENPLSCDCRVMWLHNLLVAK 400
            :::...|:||:.|:.:   .|...||.....||||  .|:.|..:.||.:|.|.:.|....:...
Human   254 QLRPEDLAGLAALQELDVSNLSLQALPGDLSGLFP--RLRLLAAARNPFNCVCPLSWFGPWVRES 316

  Fly   401 NASQDDVSELLCEFPERLRGESLRHLNPAMMGC 433
            :.:.....|..|.||.:..|..|..|:.|..||
Human   317 HVTLASPEETRCHFPPKNAGRLLLELDYADFGC 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 5/18 (28%)
LRR 82..406 CDD:443914 85/326 (26%)
leucine-rich repeat 84..107 CDD:275380 8/22 (36%)
leucine-rich repeat 108..131 CDD:275380 9/22 (41%)
leucine-rich repeat 132..155 CDD:275380 0/22 (0%)
leucine-rich repeat 156..179 CDD:275380 12/22 (55%)
leucine-rich repeat 180..204 CDD:275380 8/23 (35%)
leucine-rich repeat 205..228 CDD:275380 6/22 (27%)
leucine-rich repeat 229..252 CDD:275380 6/22 (27%)
leucine-rich repeat 253..276 CDD:275380 10/22 (45%)
leucine-rich repeat 277..300 CDD:275380 2/22 (9%)
leucine-rich repeat 301..322 CDD:275380 2/20 (10%)
leucine-rich repeat 326..350 CDD:275380 6/23 (26%)
leucine-rich repeat 351..373 CDD:275380 8/24 (33%)
LRRCT 382..434 CDD:214507 15/52 (29%)
VASNNP_612449.2 LRRNT 23..54 CDD:214470 11/31 (35%)
leucine-rich repeat 34..56 CDD:275380 5/22 (23%)
LRR 1 52..74 6/21 (29%)
leucine-rich repeat 57..77 CDD:275380 5/19 (26%)
LRR <72..>295 CDD:443914 80/303 (26%)
LRR 2 77..98 8/20 (40%)
leucine-rich repeat 78..101 CDD:275380 8/22 (36%)
LRR 3 101..122 7/20 (35%)
leucine-rich repeat 102..125 CDD:275380 9/46 (20%)
LRR 4 125..146 10/20 (50%)
leucine-rich repeat 126..149 CDD:275380 12/22 (55%)
LRR 5 149..170 8/24 (33%)
leucine-rich repeat 150..193 CDD:275380 15/47 (32%)
LRR 6 171..191 5/20 (25%)
LRR 7 193..214 5/20 (25%)
leucine-rich repeat 194..217 CDD:275380 6/22 (27%)
LRR 8 217..238 10/45 (22%)
leucine-rich repeat 218..240 CDD:275380 12/46 (26%)
LRR 9 240..262 6/46 (13%)
leucine-rich repeat 241..265 CDD:275380 8/48 (17%)
LRR 10 265..287 5/21 (24%)
leucine-rich repeat 266..286 CDD:275380 4/19 (21%)
PCC 270..>349 CDD:188093 22/80 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 358..404
EGF 409..440 CDD:394967
fn3 466..535 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.