DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and ELFN2

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_443138.2 Gene:ELFN2 / 114794 HGNCID:29396 Length:820 Species:Homo sapiens


Alignment Length:865 Identity:182/865 - (21%)
Similarity:278/865 - (32%) Gaps:256/865 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IGVEPAAGLANCPPGCQCDDNTLV---------VQCGEGQ--LDVLPIALNPSIQRLVIKSNKIK 72
            :|:..||.|..|.||....|..|:         ..|.:.|  .:.:|..:|.::..|.:..||:|
Human     4 LGLCAAALLCVCRPGAVRADCWLIEGDKGYVWLAICSQNQPPYETIPQHINSTVHDLRLNENKLK 68

  Fly    73 TIDSSIQFYAELTFLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNL 137
            .:     .|:.|                               |:.|.:           |.|||
Human    69 AV-----LYSSL-------------------------------NRFGNL-----------TDLNL 86

  Fly   138 RGNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVIFQAM 202
            ..|:||.:..|.|.....::.|.||.|::..|......|:|:|:.|::..| |..|..|..|...
Human    87 TKNEISYIEDGAFLGQSSLQVLQLGYNKLSNLTEGMLRGMSRLQFLFVQHN-LIEVVTPTAFSEC 150

  Fly   203 PSLAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLSDNRLDRIP 267
            |||..:.|..|.|..:....|..|..|...||.|... |...|.|..|..|.:.:......||:.
Human   151 PSLISIDLSSNRLSRLDGATFASLASLMVCELAGNPF-NCECDLFGFLAWLVVFNNVTKNYDRLQ 214

  Fly   268 SVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEV---NGALRLKRVM--TGAFSDNGNLE 327
            .....:..          .:.::....:..|..:..|:.   ||:|..:.|.  |...:|.....
Human   215 CESPREFA----------GYPLLVPRPYHSLNAITVLQAKCRNGSLPARPVSHPTPYSTDAQREP 269

  Fly   328 YLNLSSN-KMLLEVQEGALSGLS-------QLKHVVLKANALTSLAEGLFPWKDLQTLDLSENPL 384
            ..|...| ..:|.|:..|.|...       :|.||...:..|..:..  .|:..:..|....|..
Human   270 DENSGFNPDEILSVEPPASSTTDASAGPAIKLHHVTFTSATLVVIIP--HPYSKMYILVQYNNSY 332

  Fly   385 SCDCRVMWLHNL--LVAKNASQDDVSELLCEFPERLRGESLRHLNPAMMGCTHADPRKQALIGAL 447
            ..|  ||.|.|.  :|..:..:.......|....|    :.|..|...:..|..||     :...
Human   333 FSD--VMTLKNKKEIVTLDKLRAHTEYTFCVTSLR----NSRRFNHTCLTFTTRDP-----VPGD 386

  Fly   448 LVGSAATITALALVLYRCRHKIRETIKGGLWGN-SALG---------RKEREYQKTFCDEDYMSR 502
            |..|.:|.|          |.|. ||.|.|:|. ..||         |.:.|.||          
Human   387 LAPSTSTTT----------HYIM-TILGCLFGMVIVLGAVYYCLRKRRMQEEKQK---------- 430

  Fly   503 HQHHPCSLGIHST-FPNTYTAPHHPGATHH----YGMCP-MPVNDLGAIDPQQKFQQLVVPTATM 561
                  |:.:..| ....|.|....|:..|    .|..| :||:.:.:| |....::|  |||..
Human   431 ------SVNVKKTILEMRYGADVDAGSIVHAAQKLGEPPVLPVSRMASI-PSMIGEKL--PTAKG 486

  Fly   562 ISEKKLNNNKAL-------VSQGAIDD-----------------SASFVLHMKSATMGRDVHQQN 602
            : |..|:..|..       |..||..|                 ||:.:     :|:.::|.:.|
Human   487 L-EAGLDTPKVATKGNYIEVRTGAGGDGLARPEDDLPDLENGQGSAAEI-----STIAKEVDKVN 545

  Fly   603 PQLNH------YTKPQFLSATATVGD-----SCYSYADVPMVHGAPLGGPN--------QPQLRL 648
            ..:|:      .....||...::.||     .|.|.........|.  ||.        .|..:.
Human   546 QIINNCIDALKLDSASFLGGGSSSGDPELAFECQSLPAAAAASSAT--GPGALERPSFLSPPYKE 608

  Fly   649 TQEHFKQRELYD-----------QEMGS---------EILDH-----------NYIYSNTHYSMP 682
            :..|..||:|..           ...||         ::.||           .||...:..:.|
Human   609 SSHHPLQRQLSADAAVTRKTCSVSSSGSIKSAKVFSLDVPDHPAATGLAKGDSKYIEKGSPLNSP 673

  Fly   683 LEQLGRSKTPTPPPMPPA--------------LPLRNGLCATTGRRSF---QQKSASQKQQQNNN 730
            |::|         |:.||              |.::.....:..|.||   ..:..:....|..:
Human   674 LDRL---------PLVPAGSGGGSGGGGGIHHLEVKPAYHCSEHRHSFPALYYEEGADSLSQRVS 729

  Fly   731 TLRQFTHX--SSTYRRRQLS 748
            .|:..|..  .|||  .|||
Human   730 FLKPLTRSKRDSTY--SQLS 747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 4/17 (24%)
LRR_8 83..142 CDD:290566 8/58 (14%)
leucine-rich repeat 84..107 CDD:275380 1/22 (5%)
leucine-rich repeat 108..131 CDD:275380 2/22 (9%)
LRR_RI 129..421 CDD:238064 71/306 (23%)
LRR_8 132..190 CDD:290566 19/57 (33%)
leucine-rich repeat 132..155 CDD:275380 9/22 (41%)
leucine-rich repeat 156..179 CDD:275380 6/22 (27%)
leucine-rich repeat 180..204 CDD:275380 7/23 (30%)
LRR_8 203..263 CDD:290566 17/59 (29%)
leucine-rich repeat 205..228 CDD:275380 6/22 (27%)
leucine-rich repeat 229..252 CDD:275380 8/22 (36%)
LRR_8 252..308 CDD:290566 5/58 (9%)
leucine-rich repeat 253..276 CDD:275380 3/22 (14%)
leucine-rich repeat 277..300 CDD:275380 1/22 (5%)
leucine-rich repeat 301..322 CDD:275380 6/25 (24%)
LRR_8 325..384 CDD:290566 13/66 (20%)
leucine-rich repeat 326..350 CDD:275380 6/31 (19%)
leucine-rich repeat 351..373 CDD:275380 5/21 (24%)
ELFN2NP_443138.2 LRR 1 56..77 6/56 (11%)
leucine-rich repeat 60..80 CDD:275378 7/55 (13%)
LRR_8 80..139 CDD:316378 19/70 (27%)
LRR 2 80..101 9/31 (29%)
leucine-rich repeat 81..104 CDD:275378 9/33 (27%)
LRR 3 104..125 5/20 (25%)
leucine-rich repeat 105..128 CDD:275378 6/22 (27%)
LRR_8 127..187 CDD:316378 20/60 (33%)
LRR 4 128..149 7/21 (33%)
leucine-rich repeat 129..152 CDD:275378 7/23 (30%)
LRR 5 152..173 6/20 (30%)
leucine-rich repeat 153..166 CDD:275378 4/12 (33%)
PCC 157..>227 CDD:188093 16/80 (20%)
leucine-rich repeat 200..226 CDD:275380 3/35 (9%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..294 10/43 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 508..527 3/18 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 589..612 4/24 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 654..677 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.