DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and Chadl

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:XP_038936217.1 Gene:Chadl / 100910434 RGDID:6504353 Length:747 Species:Rattus norvegicus


Alignment Length:421 Identity:120/421 - (28%)
Similarity:166/421 - (39%) Gaps:81/421 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ILASIGVEPAAGLA--NCPPGCQCDDNTLVVQCGEGQLDVLPIALNPSIQRLVIKSNKIKTIDSS 77
            :|..:.:.||..:|  .||..|.||::...|.|....|..:|..:....||              
  Rat    20 LLLMMFLSPAWNVAAQRCPQTCVCDNSRRHVTCQHQNLTEVPDTIPELTQR-------------- 70

  Fly    78 IQFYAELTFLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLRGNQI 142
                     |||..|.|..||...|.....|..:.|.|.::.|::...|.||..:..|||..|::
  Rat    71 ---------LDLQGNMLKVIPPAAFQDLPYLTHLDLQHCQVEQVAEGAFRGLGRLLFLNLASNRL 126

  Fly   143 SELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVIFQAMPSLAE 207
            |.|.|                        :|.|||..||.|.|:.|.|..: .|..|.|:.|||.
  Rat   127 SSLPQ------------------------EALDGLGSLRRLELERNMLEEL-RPGTFGALGSLAT 166

  Fly   208 LFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLSDNRLDRIPSVGLS 272
            |.|..|.|..:.|.|||.|.....|:|...:|..::.::..||..||.|.|..|.|..:|...||
  Rat   167 LNLAHNALVYLPAMAFQGLMRTRWLQLSHNALSVLAPEALAGLPVLRRLSLHHNELQALPGAALS 231

  Fly   273 KLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALRLKRVMTGAFSDNGNLEYLNLSSNKML 337
            :...|.:|.||.|......|...:.|..|:.|.:               |:|:|:.|.       
  Rat   232 QARSLARLELGHNPLTYTGEEDGLALPGLRELAL---------------DHGSLQALG------- 274

  Fly   338 LEVQEGALSGLSQLKHVVLKANALTSLAEGLFPWKDLQTLDLSENPLSCDCRVMWLHNLLVAKNA 402
                ..|.:...:|..:.|:.|.||:|.....|.: |:.|.|..|||.|.|....|...||....
  Rat   275 ----PRAFAHCPRLHTLDLRGNQLTTLPPLQVPGQ-LRRLRLQGNPLWCACHARPLLEWLVRARV 334

  Fly   403 SQDDVSELLCEFPERLRGESLRHLNPAMMGC 433
            ..|..    |..|.|||||:|..|.|:.:.|
  Rat   335 RSDGA----CRGPRRLRGETLDTLRPSDLRC 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 2/17 (12%)
LRR_8 83..142 CDD:290566 19/58 (33%)
leucine-rich repeat 84..107 CDD:275380 8/22 (36%)
leucine-rich repeat 108..131 CDD:275380 7/22 (32%)
LRR_RI 129..421 CDD:238064 85/291 (29%)
LRR_8 132..190 CDD:290566 16/57 (28%)
leucine-rich repeat 132..155 CDD:275380 7/22 (32%)
leucine-rich repeat 156..179 CDD:275380 4/22 (18%)
leucine-rich repeat 180..204 CDD:275380 9/23 (39%)
LRR_8 203..263 CDD:290566 22/59 (37%)
leucine-rich repeat 205..228 CDD:275380 11/22 (50%)
leucine-rich repeat 229..252 CDD:275380 5/22 (23%)
LRR_8 252..308 CDD:290566 18/55 (33%)
leucine-rich repeat 253..276 CDD:275380 9/22 (41%)
leucine-rich repeat 277..300 CDD:275380 7/22 (32%)
leucine-rich repeat 301..322 CDD:275380 2/20 (10%)
LRR_8 325..384 CDD:290566 14/58 (24%)
leucine-rich repeat 326..350 CDD:275380 3/23 (13%)
leucine-rich repeat 351..373 CDD:275380 7/21 (33%)
ChadlXP_038936217.1 PLN00113 30..>555 CDD:215061 117/411 (28%)
leucine-rich repeat 48..66 CDD:275380 4/17 (24%)
leucine-rich repeat 68..91 CDD:275380 10/45 (22%)
leucine-rich repeat 92..115 CDD:275380 7/22 (32%)
leucine-rich repeat 116..139 CDD:275380 11/46 (24%)
leucine-rich repeat 140..163 CDD:275380 9/23 (39%)
leucine-rich repeat 164..187 CDD:275380 11/22 (50%)
leucine-rich repeat 188..211 CDD:275380 5/22 (23%)
leucine-rich repeat 212..235 CDD:275380 9/22 (41%)
leucine-rich repeat 236..259 CDD:275380 7/22 (32%)
leucine-rich repeat 260..283 CDD:275380 7/48 (15%)
leucine-rich repeat 306..345 CDD:275380 14/42 (33%)
leucine-rich repeat 425..448 CDD:275380
PPP1R42 446..603 CDD:411060
leucine-rich repeat 449..472 CDD:275380
leucine-rich repeat 473..496 CDD:275380
leucine-rich repeat 497..520 CDD:275380
leucine-rich repeat 521..544 CDD:275380
leucine-rich repeat 545..568 CDD:275380
leucine-rich repeat 569..592 CDD:275380
LRR_8 591..653 CDD:404697
leucine-rich repeat 593..617 CDD:275380
leucine-rich repeat 618..641 CDD:275380
leucine-rich repeat 643..665 CDD:275380
leucine-rich repeat 666..677 CDD:275378
LRRCT 673..721 CDD:214507
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.