DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment trn and LRRC3C

DIOPT Version :9

Sequence 1:	NP_001261796.1	Gene:	trn / 39491	FlyBaseID:	FBgn0010452	Length:	751	Species:	Drosophila melanogaster
Sequence 2:	NP_001182474.1	Gene:	LRRC3C / 100505591	HGNCID:	40034	Length:	275	Species:	Homo sapiens

Alignment Length:	131	Identity:	45/131 - (34%)
Similarity:	64/131 - (48%)	Gaps:	20/131 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   176 GLSQL--------RILYLDDNALTTVPDPVIFQAMPSLAELFLGMNTLQSIQADAFQDLKG-LTR 231
            |||.:        |.||||.|.|.:||... ||.:|.|.||.|..|.|..:...|||.|:| |..
Human    69 GLSAVPSGIPNDTRKLYLDANQLASVPAGA-FQHLPVLEELDLSHNALAHLSGAAFQGLEGTLRH 132

  Fly   232 LELKGASLRNISHDSFLGLQELRILDLSDNRLDRIP---SVGLSKLVRLEQLSLGQNDFEVISEG 293
            |:|....|.::..::|:||| ::: :||.|     |   ...|.:::|..:|..|.....|...|
Human   133 LDLSANQLASVPVEAFVGLQ-IQV-NLSAN-----PWHCDCALQEVLRQVRLVPGTGTGIVCGSG 190

  Fly   294 A 294
            |
Human   191 A 191

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
trn	NP_001261796.1	leucine-rich repeat	62..80	CDD:275380
		LRR_8	83..142	CDD:290566
		leucine-rich repeat	84..107	CDD:275380
		leucine-rich repeat	108..131	CDD:275380
		LRR_RI	129..421	CDD:238064	45/131 (34%)
		LRR_8	132..190	CDD:290566	9/21 (43%)
		leucine-rich repeat	132..155	CDD:275380
		leucine-rich repeat	156..179	CDD:275380	2/2 (100%)
		leucine-rich repeat	180..204	CDD:275380	11/31 (35%)
		LRR_8	203..263	CDD:290566	23/60 (38%)
		leucine-rich repeat	205..228	CDD:275380	10/22 (45%)
		leucine-rich repeat	229..252	CDD:275380	7/22 (32%)
		LRR_8	252..308	CDD:290566	11/46 (24%)
		leucine-rich repeat	253..276	CDD:275380	5/25 (20%)
		leucine-rich repeat	277..300	CDD:275380	5/18 (28%)
		leucine-rich repeat	301..322	CDD:275380
		LRR_8	325..384	CDD:290566
		leucine-rich repeat	326..350	CDD:275380
		leucine-rich repeat	351..373	CDD:275380
LRRC3C	NP_001182474.1	leucine-rich repeat	61..80	CDD:275378	3/10 (30%)
		LRR 1	80..101		10/21 (48%)
		leucine-rich repeat	81..104	CDD:275378	11/23 (48%)
		LRR_8	82..140	CDD:290566	26/58 (45%)
		LRR_4	82..120	CDD:289563	18/38 (47%)
		LRR 2	104..125		8/20 (40%)
		LRR_4	105..144	CDD:289563	15/38 (39%)
		leucine-rich repeat	105..129	CDD:275378	10/23 (43%)
		LRR 3	129..150		5/20 (25%)
		leucine-rich repeat	130..152	CDD:275378	6/21 (29%)
		leucine-rich repeat	153..164	CDD:275378	4/16 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24373
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.100