DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and lingo3

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:XP_004911049.2 Gene:lingo3 / 100497438 XenbaseID:XB-GENE-6051175 Length:605 Species:Xenopus tropicalis


Alignment Length:407 Identity:122/407 - (29%)
Similarity:198/407 - (48%) Gaps:38/407 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PAAGLANCPPGCQCDDNTLVVQCGEGQLDVLPIALNPSIQRLV-IKSNKIKTID-SSIQFYAELT 85
            |...:..||..|.|..|...|.|...:|..:|..: ||..||: :..|:|:.:: .....|:.|.
 Frog    23 PEWKVLGCPARCDCTPNQRSVICHRKRLTTIPEGI-PSETRLLDLSKNRIRCLNPGDFSPYSLLE 86

  Fly    86 FLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLRGNQISELHQGTF 150
            .:|||.|.:.||....||....||.:.|..|::..|....|..||.:|:|::..|:|..|....|
 Frog    87 EVDLSENIISTIEPGAFANLFFLQILKLKGNQLKLIPTGVFTKLSNLTLLDISENKIVILLDFMF 151

  Fly   151 TPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTV-PDPVIF-QAMPSLAELFLGMN 213
            ..|..::.|.:|:|.:.|:..|||.||..|..|.::...||:: |:.:.: |.:..|...:||:|
 Frog   152 QDLRSLKSLEVGDNDLLYISQKAFYGLVSLDQLTIEKCNLTSISPESLSYLQGLEVLRLRYLGIN 216

  Fly   214 TLQSIQADAFQDLKGLTRLELKG-ASLRNISHDSFLGLQELRILDLSDNRLDRIPSVGLSKLVRL 277
               |::...||.|..|..|||:. ..|.::.:.:|.|| .|..|.::...|..:||..|..:|.|
 Frog   217 ---SLEEQNFQKLYNLKELELESWPLLEDVCNTAFQGL-NLTSLSITYTNLTSVPSAALRNMVYL 277

  Fly   278 EQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALRLKRVMTGAFSDNGNLEYLNLSSNKMLLEVQE 342
            |.|:|..|...:|..|||..|.:|:.|.:.||. |..|.:.||.....:..||:|:| :|..::|
 Frog   278 EYLNLSFNPIRIIQRGAFKDLVRLRELHIVGAF-LSTVESQAFLGLRQIRLLNVSNN-LLATLEE 340

  Fly   343 GALSGLSQLKHVVLKANALTSLAEGLFPWKDLQTLDLSENPLSCDCRVMWLHNLLVAKNASQDDV 407
            .|...::                       .|:||.:.:|||:||||::|   :|..:.....|.
 Frog   341 SAFQSVN-----------------------TLETLRVDDNPLACDCRLLW---ILQRRKTLNFDN 379

  Fly   408 SELLCEFPERLRGESLR 424
            .:.:|..|.:::|.:||
 Frog   380 HQPVCASPAKIQGNALR 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 4/19 (21%)
LRR_8 83..142 CDD:290566 20/58 (34%)
leucine-rich repeat 84..107 CDD:275380 9/22 (41%)
leucine-rich repeat 108..131 CDD:275380 7/22 (32%)
LRR_RI 129..421 CDD:238064 87/294 (30%)
LRR_8 132..190 CDD:290566 18/57 (32%)
leucine-rich repeat 132..155 CDD:275380 7/22 (32%)
leucine-rich repeat 156..179 CDD:275380 9/22 (41%)
leucine-rich repeat 180..204 CDD:275380 6/25 (24%)
LRR_8 203..263 CDD:290566 18/60 (30%)
leucine-rich repeat 205..228 CDD:275380 8/22 (36%)
leucine-rich repeat 229..252 CDD:275380 8/23 (35%)
LRR_8 252..308 CDD:290566 19/55 (35%)
leucine-rich repeat 253..276 CDD:275380 6/22 (27%)
leucine-rich repeat 277..300 CDD:275380 10/22 (45%)
leucine-rich repeat 301..322 CDD:275380 8/20 (40%)
LRR_8 325..384 CDD:290566 11/58 (19%)
leucine-rich repeat 326..350 CDD:275380 7/23 (30%)
leucine-rich repeat 351..373 CDD:275380 0/21 (0%)
lingo3XP_004911049.2 LRR 41..359 CDD:227223 102/347 (29%)
leucine-rich repeat 61..84 CDD:275380 5/22 (23%)
leucine-rich repeat 85..108 CDD:275380 9/22 (41%)
leucine-rich repeat 109..132 CDD:275380 7/22 (32%)
leucine-rich repeat 133..156 CDD:275380 7/22 (32%)
leucine-rich repeat 157..180 CDD:275380 9/22 (41%)
leucine-rich repeat 181..204 CDD:275380 5/22 (23%)
leucine-rich repeat 205..228 CDD:275380 8/25 (32%)
leucine-rich repeat 229..252 CDD:275380 8/23 (35%)
leucine-rich repeat 253..276 CDD:275380 6/22 (27%)
leucine-rich repeat 277..298 CDD:275380 9/20 (45%)
leucine-rich repeat 301..324 CDD:275380 8/23 (35%)
leucine-rich repeat 325..345 CDD:275380 7/20 (35%)
PCC 329..>399 CDD:188093 24/95 (25%)
Ig 413..502 CDD:416386
Ig strand A' 419..423 CDD:409353
Ig strand B 429..438 CDD:409353
Ig strand C 443..448 CDD:409353
Ig strand C' 451..453 CDD:409353
Ig strand D 462..465 CDD:409353
Ig strand E 468..475 CDD:409353
Ig strand F 481..489 CDD:409353
Ig strand G 492..502 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14097
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6410
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.