DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and lrrc15

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:XP_031758235.1 Gene:lrrc15 / 100496322 XenbaseID:XB-GENE-990725 Length:588 Species:Xenopus tropicalis


Alignment Length:439 Identity:119/439 - (27%)
Similarity:193/439 - (43%) Gaps:66/439 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CPPGCQCDDNTLVVQCGEGQLDVLPIALNPSIQRLVIKSNKIKTIDSSI-QFYAELTFLDLSSNH 93
            ||..|.| .....|.|...::.|:|..:..:|:.|.|.:.::..:.:.| |....|..|.:..|.
 Frog    23 CPSDCIC-PRPGQVDCSGPEVLVIPDNIPQNIRTLQIVNTEVTELPNGILQNMTALLILRIEKNE 86

  Fly    94 LMTIPQRTF----------AYQKKLQEVH--------------LNHNKIGQISNKTFIGLSAVTV 134
            |.|:....|          ....||||:|              |::|:|.||....|..||.|..
 Frog    87 LSTVGSTAFHNLISLRYLSLANNKLQELHGNLFKDLAKLETLILSNNQINQIHPSLFTALSNVKD 151

  Fly   135 LNLRGNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVI- 198
            |.:.||.:..:..|.|..:..:.:|||.:|.|.||.|:|||.|::|:.|.|.:|.|..:|...: 
 Frog   152 LQMVGNNLESIPVGAFDQMSGLLKLNLAKNSIKYLPPQAFDKLAKLQTLRLYENQLQDIPAGFLK 216

  Fly   199 ----------------------FQAMPSLAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRN 241
                                  |...|.|.::||..|.:.|:....|.:|..:|:|.|.|.:||.
 Frog   217 KLSSLQEVALHSNKLIELSTDTFSGNPYLQKVFLSNNEIDSLPRGIFLNLPEITKLTLYGNALRE 281

  Fly   242 ISHDSFLGLQELRILDLSDNRLDRIPSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEV 306
            ::...|..:.:|:.|.|.||:|:::.....|.|.....|.:.:|....||..||.||::|:.|.:
 Frog   282 LTTGVFGPMPKLKELWLYDNQLEQLTDNVFSNLTETVLLVISKNKIRSISTHAFCGLEELQELSL 346

  Fly   307 NGALRLKRVMTGAFSDNGNLEYLNLSSNKMLLEVQEGAL-SGLSQLKHVVLKANALTSLAEGLF- 369
            :..| |..:..........|:.::|.|||  ::...|.| ..:..:.::.|:.|:|..:....| 
 Frog   347 HTNL-LTTLDQDVLKCLPKLQNISLHSNK--IQYLPGDLFKNMDTVMNIQLQNNSLEDIPHDFFD 408

  Fly   370 PWKDLQTLDLSENPLSCDCRVMWLHNLLVAKNASQD------DVSELLC 412
            ....|..:.|.|||..||      ||||..||...:      ::|:|:|
 Frog   409 SLVQLNEVKLYENPWKCD------HNLLSLKNWLSENMNKLGNLSQLVC 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 3/18 (17%)
LRR_8 83..142 CDD:290566 23/82 (28%)
leucine-rich repeat 84..107 CDD:275380 6/32 (19%)
leucine-rich repeat 108..131 CDD:275380 11/36 (31%)
LRR_RI 129..421 CDD:238064 89/315 (28%)
LRR_8 132..190 CDD:290566 22/57 (39%)
leucine-rich repeat 132..155 CDD:275380 6/22 (27%)
leucine-rich repeat 156..179 CDD:275380 12/22 (55%)
leucine-rich repeat 180..204 CDD:275380 7/46 (15%)
LRR_8 203..263 CDD:290566 20/59 (34%)
leucine-rich repeat 205..228 CDD:275380 7/22 (32%)
leucine-rich repeat 229..252 CDD:275380 7/22 (32%)
LRR_8 252..308 CDD:290566 18/55 (33%)
leucine-rich repeat 253..276 CDD:275380 8/22 (36%)
leucine-rich repeat 277..300 CDD:275380 8/22 (36%)
leucine-rich repeat 301..322 CDD:275380 4/20 (20%)
LRR_8 325..384 CDD:290566 15/60 (25%)
leucine-rich repeat 326..350 CDD:275380 7/24 (29%)
leucine-rich repeat 351..373 CDD:275380 4/22 (18%)
lrrc15XP_031758235.1 leucine-rich repeat 35..51 CDD:275380 4/15 (27%)
LRR_8 51..111 CDD:404697 11/59 (19%)
leucine-rich repeat 54..76 CDD:275380 4/21 (19%)
leucine-rich repeat 77..100 CDD:275380 6/22 (27%)
internalin_A 98..>449 CDD:380193 98/359 (27%)
leucine-rich repeat 101..124 CDD:275380 5/22 (23%)
leucine-rich repeat 125..148 CDD:275380 7/22 (32%)
leucine-rich repeat 149..172 CDD:275380 6/22 (27%)
leucine-rich repeat 173..196 CDD:275380 12/22 (55%)
leucine-rich repeat 197..220 CDD:275380 6/22 (27%)
leucine-rich repeat 221..244 CDD:275380 1/22 (5%)
leucine-rich repeat 245..268 CDD:275380 7/22 (32%)
leucine-rich repeat 269..292 CDD:275380 7/22 (32%)
leucine-rich repeat 293..316 CDD:275380 8/22 (36%)
leucine-rich repeat 317..340 CDD:275380 8/22 (36%)
leucine-rich repeat 341..362 CDD:275380 4/21 (19%)
leucine-rich repeat 365..388 CDD:275380 7/24 (29%)
leucine-rich repeat 389..410 CDD:275380 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47585
Panther 1 1.100 - - O PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.