DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and chadl

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:XP_002934783.2 Gene:chadl / 100491048 XenbaseID:XB-GENE-6050564 Length:721 Species:Xenopus tropicalis


Alignment Length:723 Identity:144/723 - (19%)
Similarity:236/723 - (32%) Gaps:308/723 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IWCILASI---GVEPAAGLANCPPGCQCDDNTLVVQCGEGQLDVLPIALNPSIQRLVIKSNKIKT 73
            :|.:|..|   .|:|.. ...||..|.||:....|.|....|..:|.::....|:|.::.|.:|.
 Frog     2 MWFVLTLIIMSAVKPLL-CDRCPRVCICDNIRTFVACTNKNLTEVPTSIPQYTQKLDLRGNDLKV 65

  Fly    74 IDS----SIQFYAELTFLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTV 134
            |.:    |:.:   ||.|.|...::..|.:.......:|..::|..|||..|..::|.|||::..
 Frog    66 IPNGAFLSVPY---LTHLSLQKCNIERIEEGALRGLGRLVYLNLGSNKISFIYQESFDGLSSLQQ 127

  Fly   135 LNLRGNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVIF 199
            |.|..|::.|:..|.|..|..:..|:||:|.:.||....|.||.|::.:.|.:|.:..|.:.. |
 Frog   128 LVLEKNRLEEIKPGAFGQLGFLNFLHLGDNFLVYLPDMLFQGLQQVKWIRLSNNMINVVSNEA-F 191

  Fly   200 QAMPSLAELFLGMNTLQSIQADAFQDLKGLTRLE-----------------------LKGASLRN 241
            .|:|:|..|.|..|.||.:..||...:.||||||                       |...::::
 Frog   192 AALPNLKRLSLDHNELQYLPTDALSRMSGLTRLELGWNPMTFISEEAVQMASLKQLFLNNMAIQD 256

  Fly   242 ISHDSFLGLQELRILDLSDNRLDRIPSV-GLSKLVRLE--------------------------- 278
            :|..:|....:|.::|||:|::..|..: ||..|.||.                           
 Frog   257 LSFKAFERSPQLSLIDLSNNQIRTIQVLAGLEHLNRLNLTGNAIRCDCELRSFKQWADFSKVKVD 321

  Fly   279 ----------------------------------------------------------------- 278
                                                                             
 Frog   322 LFCSGPGHFRGDHLDSLRAIDLKCGNFPEEDYNLPPITPKPEEESSCPRSCDCKPDDKHVLCENK 386

  Fly   279 --------------QLSLGQNDFEVISEGAFMGLKQLKRLE------------------------ 305
                          .|.|.:|.|..|.:|||..:|.:..|.                        
 Frog   387 FLQQIPKRFPVDTTLLDLRKNVFNAIHKGAFSEMKNVASLHLQSCQINEIQPGAFAGMKNLVYLY 451

  Fly   306 -------------------------------------------------------------VNGA 309
                                                                         ::||
 Frog   452 LSHNHLSSIDPEVFRDAPMIGYLYLDHNRFTRLSKGTFKFLPNLFSLHMQYNSISSLSDNFMSGA 516

  Fly   310 LRLKRV-MTG---------AFSDNGNLEYLNLSSNKMLLEVQEGALSGLSQLKHVVLKANALTSL 364
            .:|..| |||         ||.:|.:||.|:|..| :|:||...|:.||..|..:.|..|.:.|:
 Frog   517 DKLHWVYMTGNNINYIASSAFKNNKDLEKLHLDEN-LLMEVPTQAIKGLPLLNELRLSKNLIRSI 580

  Fly   365 AEGLF-------------------------------------------------PWKDLQTLDLS 380
            ..|.|                                                 |:..|:.::|:
 Frog   581 GNGAFLPVARSLQHLYLNDLGLEQISSGGFSGLGQGIKSLHLDNNKLQNIPNMKPFTGLEVINLA 645

  Fly   381 ENPLSCDCRVM----WLHNLLVAKNASQDDVSELLCEFPERLRGESLRHL-------NPAMMGCT 434
            .||..||||::    |:::|.:...|:        |..|...:|:.:|:.       |.|  |.|
 Frog   646 NNPFHCDCRLLPLHKWINSLNLKVGAT--------CAAPSSAKGQKVRNAPFSTCPGNDA--GKT 700

  Fly   435 HADPRKQA 442
            :::.:|::
 Frog   701 NSNKKKRS 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 6/21 (29%)
LRR_8 83..142 CDD:290566 18/58 (31%)
leucine-rich repeat 84..107 CDD:275380 5/22 (23%)
leucine-rich repeat 108..131 CDD:275380 9/22 (41%)
LRR_RI 129..421 CDD:238064 104/569 (18%)
LRR_8 132..190 CDD:290566 19/57 (33%)
leucine-rich repeat 132..155 CDD:275380 7/22 (32%)
leucine-rich repeat 156..179 CDD:275380 9/22 (41%)
leucine-rich repeat 180..204 CDD:275380 5/23 (22%)
LRR_8 203..263 CDD:290566 23/82 (28%)
leucine-rich repeat 205..228 CDD:275380 8/22 (36%)
leucine-rich repeat 229..252 CDD:275380 8/45 (18%)
LRR_8 252..308 CDD:290566 21/247 (9%)
leucine-rich repeat 253..276 CDD:275380 9/23 (39%)
leucine-rich repeat 277..300 CDD:275380 9/128 (7%)
leucine-rich repeat 301..322 CDD:275380 10/115 (9%)
LRR_8 325..384 CDD:290566 21/107 (20%)
leucine-rich repeat 326..350 CDD:275380 11/23 (48%)
leucine-rich repeat 351..373 CDD:275380 7/70 (10%)
chadlXP_002934783.2 PPP1R42 37..232 CDD:411060 61/198 (31%)
leucine-rich repeat 53..76 CDD:275380 6/22 (27%)
leucine-rich repeat 77..100 CDD:275380 5/22 (23%)
leucine-rich repeat 101..124 CDD:275380 9/22 (41%)
leucine-rich repeat 125..148 CDD:275380 7/22 (32%)
leucine-rich repeat 149..172 CDD:275380 9/22 (41%)
leucine-rich repeat 173..196 CDD:275380 5/23 (22%)
leucine-rich repeat 197..220 CDD:275380 8/22 (36%)
leucine-rich repeat 221..243 CDD:275380 5/21 (24%)
leucine-rich repeat 244..267 CDD:275380 3/22 (14%)
leucine-rich repeat 268..287 CDD:275380 6/18 (33%)
PCC 272..>346 CDD:188093 10/73 (14%)
leucine-rich repeat 290..337 CDD:275380 3/46 (7%)
inl_like_NEAT_1 <359..>647 CDD:411101 40/288 (14%)
leucine-rich repeat 399..422 CDD:275380 8/22 (36%)
LRR_8 422..481 CDD:404697 1/58 (2%)
leucine-rich repeat 423..446 CDD:275380 1/22 (5%)
leucine-rich repeat 447..470 CDD:275380 0/22 (0%)
leucine-rich repeat 471..494 CDD:275380 0/22 (0%)
leucine-rich repeat 495..518 CDD:275380 2/22 (9%)
leucine-rich repeat 519..542 CDD:275380 8/22 (36%)
leucine-rich repeat 543..566 CDD:275380 11/23 (48%)
leucine-rich repeat 567..591 CDD:275380 6/23 (26%)
leucine-rich repeat 592..615 CDD:275380 0/22 (0%)
leucine-rich repeat 617..639 CDD:275380 1/21 (5%)
leucine-rich repeat 640..651 CDD:275378 3/10 (30%)
LRRCT 647..693 CDD:214507 13/53 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.