DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trn and lrrc3

DIOPT Version :9

Sequence 1:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001107114.1 Gene:lrrc3 / 100001372 ZFINID:ZDB-GENE-080327-13 Length:266 Species:Danio rerio


Alignment Length:314 Identity:64/314 - (20%)
Similarity:111/314 - (35%) Gaps:83/314 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 PVIFQAMPSLAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNI----SHDSFLGLQELRIL 256
            |:||:.:  ||.:.|.:.:....::....:...||.::....:|..|    .||:.       .|
Zfish    20 PLIFRLL--LAVICLSVPSFACPKSCHCSERNSLTVVQCSSRNLEEIPPDLPHDTV-------SL 75

  Fly   257 DLSDNRLDRIPSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALRLKRVMTGAFS 321
            .||.|.:.:||:.....|..|::|.|.:|..|.:..|||.|:.:                     
Zfish    76 QLSSNHITKIPNQAFKNLPWLQELDLSRNAIETVDAGAFKGVSE--------------------- 119

  Fly   322 DNGNLEYLNLSSNKMLLEVQEGALSGLSQLKHVVLKANALTSLAEGLFPWKDLQTLDLSENPLSC 386
               :|..|:||.|.|         .|:.:.....|.|.                 :.||.||..|
Zfish   120 ---SLRTLDLSHNHM---------QGVPKEAFARLHAK-----------------ISLSNNPWHC 155

  Fly   387 DCRVMWLHNLLVAKNASQDDVSELLCEF--PERLRGES-LRHLNPAMMGCTHADPRKQALIGALL 448
            :|.   |..:|.......:.|:|:.|..  .|:..|:. ::.|:..:..|..........:...:
Zfish   156 ECT---LQEVLRELRLDPETVNEVSCHTSDQEKYAGKPVIQVLDSGINFCNFHHKTTDVAMFVTM 217

  Fly   449 VGSAATITALALVLYRCRHKIRETIKGGLWGNSALGRKEREYQKTFCDEDYMSR 502
            .|....:  :|.|:|..||            |....|:..||.|:......:|:
Zfish   218 FGWFTMV--IAYVIYYVRH------------NQEDARRHLEYLKSLPSSSQISK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380
LRR_8 83..142 CDD:290566
leucine-rich repeat 84..107 CDD:275380
leucine-rich repeat 108..131 CDD:275380
LRR_RI 129..421 CDD:238064 49/230 (21%)
LRR_8 132..190 CDD:290566
leucine-rich repeat 132..155 CDD:275380
leucine-rich repeat 156..179 CDD:275380
leucine-rich repeat 180..204 CDD:275380 3/7 (43%)
LRR_8 203..263 CDD:290566 13/63 (21%)
leucine-rich repeat 205..228 CDD:275380 3/22 (14%)
leucine-rich repeat 229..252 CDD:275380 6/26 (23%)
LRR_8 252..308 CDD:290566 16/55 (29%)
leucine-rich repeat 253..276 CDD:275380 7/22 (32%)
leucine-rich repeat 277..300 CDD:275380 9/22 (41%)
leucine-rich repeat 301..322 CDD:275380 0/20 (0%)
LRR_8 325..384 CDD:290566 12/58 (21%)
leucine-rich repeat 326..350 CDD:275380 7/23 (30%)
leucine-rich repeat 351..373 CDD:275380 2/21 (10%)
lrrc3NP_001107114.1 LRR_RI <14..161 CDD:238064 44/202 (22%)
LRRNT 38..72 CDD:214470 5/33 (15%)
leucine-rich repeat 51..74 CDD:275378 6/29 (21%)
LRR 1 71..92 7/27 (26%)
LRR_8 74..131 CDD:290566 21/80 (26%)
LRR_4 74..111 CDD:289563 12/36 (33%)
leucine-rich repeat 75..95 CDD:275378 7/19 (37%)
LRR 2 95..116 8/20 (40%)
leucine-rich repeat 96..120 CDD:275378 9/47 (19%)
LRR 3 120..141 7/29 (24%)
leucine-rich repeat 121..144 CDD:275378 8/31 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.