DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LDLR and CG32432

DIOPT Version :9

Sequence 1:NP_000518.1 Gene:LDLR / 3949 HGNCID:6547 Length:860 Species:Homo sapiens
Sequence 2:NP_649266.1 Gene:CG32432 / 40310 FlyBaseID:FBgn0052432 Length:1307 Species:Drosophila melanogaster


Alignment Length:438 Identity:87/438 - (19%)
Similarity:150/438 - (34%) Gaps:129/438 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   271 VNVTLCEGPN-------KFKCHSGECITLDKVCNMARDCRDWSDEP----------IKECGTNEC 318
            ||:.|..|.:       :|.|.:|.|:.|.|.||...||.|.||||          ..:.|....
  Fly   201 VNLQLAPGSSSTGCSLAEFSCSNGRCVPLSKYCNNLNDCGDGSDEPRFCTRCNRTYYGDIGQTYA 265

Human   319 LDNNGGCSHVCNDLKIGYECL---------------------------------CPDGFQLVAQR 350
            |:     .|.....::.:.|:                                 ||||:..:|:.
  Fly   266 LE-----LHRPKQDRVPFVCVLTFTAAGGQHGDVVQVTLDSFTIGRFTSYVHEGCPDGYMQIAES 325

Human   351 RCEDIDECQDPDTCSQLCVNLEGGYKCQCEEG---FQLDPHTKACKAVGSIAYLFFTNRHEVRKM 412
            ....|                 ||..|....|   |..:..:           |.||.|  :.::
  Fly   326 ARTPI-----------------GGMWCGSSWGPVLFYSETRS-----------LIFTIR--LNRL 360

Human   413 TLDRSEYTSLIPNLRNVVALDTEVAS-NRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAP 476
            ..|:|.|.........|::.|:.|.. ..|..::|:|....|:.|::............:..|..
  Fly   361 ARDQSGYNFDFRIRYKVLSRDSSVTRYGGIKLAELAQWHNRSSFLNQQQQQQQQQQQQQQQQQGA 425

Human   477 DGLAVDWIHSNI-----YWTDSVLGTVSVADTK---GVKRKTLFR--ENGSKPRAIVVDPVHG-- 529
            .|:..|:.:|::     |..|..|.: :.|:.|   ....|:|.:  :|.::|:..:.|.:.|  
  Fly   426 PGILEDFTNSSVARSDRYGQDFSLFS-AYANNKTFMASLEKSLAKDEQNYTEPKYYLGDLIPGTY 489

Human   530 -FMYWTDWG-TPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNG 592
             ...::|.. .|.:::.....|:           :|..:|. ..:.|.:.|....|::..:....
  Fly   490 CSRIFSDCDKKPCRLQSPNFPGI-----------YPRNLTC-YYAVRQHDVPHGKHALILVKQPK 542

Human   593 GNRKTILEDE----KRLAHPFSLAVFEDKVF------WT--DIINEAI 628
            ||...|...|    .::|.|.| |..:||.|      |.  |.|.|.:
  Fly   543 GNLVWISTQETAAANKMAPPPS-ASDKDKKFEPRLKTWNYCDYIQENV 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LDLRNP_000518.1 Ldl_recept_a 25..58 CDD:278486
Ldl_recept_a 66..104 CDD:278486
Ldl_recept_a 107..143 CDD:278486
Ldl_recept_a 147..179 CDD:278486
Ldl_recept_a 195..231 CDD:278486
Ldl_recept_a 235..270 CDD:278486
LDLa 278..308 CDD:294076 13/36 (36%)
FXa_inhibition 318..>346 CDD:291342 7/60 (12%)
EGF_CA 354..388 CDD:214542 6/36 (17%)
LDL-receptor class B 1 397..438 10/40 (25%)
LY 419..457 CDD:214531 8/38 (21%)
LDL-receptor class B 2 439..485 8/45 (18%)
Ldl_recept_b 439..482 CDD:278487 7/42 (17%)
LDL-receptor class B 3 486..528 11/51 (22%)
Ldl_recept_b 487..525 CDD:278487 9/47 (19%)
LDL-receptor class B 4 529..572 6/46 (13%)
Ldl_recept_b 529..569 CDD:278487 6/43 (14%)
LY 553..595 CDD:214531 6/41 (15%)
LDL-receptor class B 5 573..615 11/45 (24%)
LDL-receptor class B 6 616..658 7/21 (33%)
Ldl_recept_b 616..655 CDD:278487 7/21 (33%)
FXa_inhibition 671..711 CDD:291342
Clustered O-linked oligosaccharides 721..768
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 734..755
Required for MYLIP-triggered down-regulation of LDLR. /evidence=ECO:0000269|PubMed:19520913 811..860
NPXY motif. /evidence=ECO:0000269|PubMed:22509010 823..828
CG32432NP_649266.1 LDLa 214..245 CDD:197566 12/30 (40%)
CUB 503..646 CDD:238001 21/100 (21%)
LDLa 1203..1231 CDD:197566
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.