DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LDLR and cue

DIOPT Version :9

Sequence 1:NP_000518.1 Gene:LDLR / 3949 HGNCID:6547 Length:860 Species:Homo sapiens
Sequence 2:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster


Alignment Length:381 Identity:84/381 - (22%)
Similarity:154/381 - (40%) Gaps:89/381 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   393 KAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQR--MICSTQ 455
            :.:.:.|:.|    .|:..:|.|.||                    ..||::||..|  .|.|.:
  Fly    49 QTIATAAHEF----DELSALTFDESE--------------------ELIYFNDLKHRNGSIFSLK 89

Human   456 LD--RAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRE---N 515
            .|  .|:.|:. .|:.....::..|||.|.::.|::|:|:....:..|...|.....:..:   .
  Fly    90 RDLIAANHVAE-QTIARTGNESVGGLAYDPLNMNLFWSDTEQRKIFFAPIHGSATPQVLVDLSAE 153

Human   516 GSKPRAIVVDPVHGFMYWTDWG-TPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVD 579
            |.:|..:.||.....:|||:.. |...:::..|:|.:...:::.||..|.||.:|.||.||:|:|
  Fly   154 GGRPDGVAVDVCRRKLYWTNSNVTHPTVERINLDGSNRTVIISSNIDMPRGIVVDQLSDRLFWID 218

Human   580 ---SKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNL 641
               ....|:.|..::|.:|:.:|:|:..  .|.:|||..|.::|||....|::|..::....|..
  Fly   219 DLKGVFFSVESSKLDGSDRQVVLKDKHH--EPLNLAVTNDAIYWTDRTTRAVWSHPKVPVIKVTT 281

Human   642 LAE----------NLLSPE------DMVLFHNLT-QPRGV----NWCERTTLSNGGCQYLCLPAP 685
            .::          :...||      .:|...||: :.||:    .:.:|....:.....:.....
  Fly   282 TSKPDEEDSTDSTDFKDPEPVAEDCPLVRVANLSEEARGIVARTGFYQRLQKDHHCASIVRKVKE 346

Human   686 QINPHSPKF-----------------------------TCACPDGMLLAR-DMRSC 711
            :::..|.||                             .|.||.|...:| ::|.|
  Fly   347 RVDEQSRKFEIRSLLDQKIKVLEDERCMNDGEYRAATDLCICPTGFKGSRCEIREC 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LDLRNP_000518.1 Ldl_recept_a 25..58 CDD:278486
Ldl_recept_a 66..104 CDD:278486
Ldl_recept_a 107..143 CDD:278486
Ldl_recept_a 147..179 CDD:278486
Ldl_recept_a 195..231 CDD:278486
Ldl_recept_a 235..270 CDD:278486
LDLa 278..308 CDD:294076
FXa_inhibition 318..>346 CDD:291342
EGF_CA 354..388 CDD:214542
LDL-receptor class B 1 397..438 7/40 (18%)
LY 419..457 CDD:214531 7/39 (18%)
LDL-receptor class B 2 439..485 15/49 (31%)
Ldl_recept_b 439..482 CDD:278487 14/46 (30%)
LDL-receptor class B 3 486..528 9/44 (20%)
Ldl_recept_b 487..525 CDD:278487 7/40 (18%)
LDL-receptor class B 4 529..572 12/43 (28%)
Ldl_recept_b 529..569 CDD:278487 11/40 (28%)
LY 553..595 CDD:214531 15/44 (34%)
LDL-receptor class B 5 573..615 14/44 (32%)
LDL-receptor class B 6 616..658 10/57 (18%)
Ldl_recept_b 616..655 CDD:278487 10/54 (19%)
FXa_inhibition 671..711 CDD:291342 9/69 (13%)
Clustered O-linked oligosaccharides 721..768
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 734..755
Required for MYLIP-triggered down-regulation of LDLR. /evidence=ECO:0000269|PubMed:19520913 811..860
NPXY motif. /evidence=ECO:0000269|PubMed:22509010 823..828
cueNP_612113.2 LY 101..141 CDD:214531 9/39 (23%)
Ldl_recept_b 167..208 CDD:278487 11/40 (28%)
LY 193..237 CDD:214531 15/43 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.