DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LDLR and CG6553

DIOPT Version :10

Sequence 1:NP_000518.1 Gene:LDLR / 3949 HGNCID:6547 Length:860 Species:Homo sapiens
Sequence 2:NP_610911.1 Gene:CG6553 / 36537 FlyBaseID:FBgn0033880 Length:319 Species:Drosophila melanogaster


Alignment Length:268 Identity:74/268 - (27%)
Similarity:100/268 - (37%) Gaps:62/268 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   115 RCHDGKCISRQFVCDSDRDCLDGSDE--ASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGS 177
            ||..|.||....:||...:|||||||  |.|..:.|...:|:|:...||.....||...||.|||
  Fly    35 RCGGGDCIQLDQLCDGSANCLDGSDE
TVAMCEKVWCPGYAFRCSYGACIASTAVCDGVQDCVDGS 99

Human   178 DEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDE-----ENCAVATCR 237
            ||....||.    |...:.|..:|.:|.||:|:..|..|||..||:|..||     |...:.|..
  Fly   100 DE
QGWLCRA----QMQQANCDNWEMYCSSGQCMTYSKLCDGIRDCRDGDDELESLCEGVTIPTTT 160

Human   238 -PDEFQCSDGNCIHG-------SRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDK 294
             ......:..:.||.       :|:..|                     ||..: .:|||:....
  Fly   161 VSSTTSTTTESSIHRITPTVPVTRKASR---------------------PNPLQ-ENGECVVPQL 203

Human   295 VCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCED----- 354
            ...|.:...|    .|...|           |.|.|..:|.|:|......:...|..|:|     
  Fly   204 PNVMVKHFTD----AILTVG-----------SRVANGTRIYYDCPAEHRLKGENQNICQDALWAR 253

Human   355 -IDECQDP 361
             ...|:.|
  Fly   254 KFPYCETP 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LDLRNP_000518.1 Ldl_recept_a 25..58 CDD:395011
Ldl_recept_a 66..104 CDD:395011
Ldl_recept_a 107..143 CDD:395011 15/29 (52%)
Binding to Getah virus E1-E2 spike glycoproteins. /evidence=ECO:0000269|PubMed:38245515 146..233 33/91 (36%)
Ldl_recept_a 147..179 CDD:395011 12/31 (39%)
Ldl_recept_a 195..231 CDD:395011 16/40 (40%)
Ldl_recept_a 235..270 CDD:395011 5/42 (12%)
Ldl_recept_a 278..308 CDD:395011 7/29 (24%)
FXa_inhibition 318..>346 CDD:464251 6/27 (22%)
EGF_CA 354..388 CDD:214542 3/14 (21%)
LDL-receptor class B 1 397..438
LY 419..457 CDD:214531
LDL-receptor class B 2 439..485
Ldl_recept_b 439..483 CDD:459654
LDL-receptor class B 3 486..528
Ldl_recept_b 487..526 CDD:459654
LDL-receptor class B 4 529..572
Ldl_recept_b 529..569 CDD:459654
LY 553..595 CDD:214531
LDL-receptor class B 5 573..615
LDL-receptor class B 6 616..658
Ldl_recept_b 616..656 CDD:459654
FXa_inhibition 671..711 CDD:464251
Clustered O-linked oligosaccharides 721..768
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 734..755
Required for MYLIP-triggered down-regulation of LDLR. /evidence=ECO:0000269|PubMed:19520913 811..860
NPXY motif. /evidence=ECO:0000269|PubMed:22509010 823..828
CG6553NP_610911.1 LDLa 34..60 CDD:197566 12/24 (50%)
LDLa 70..101 CDD:197566 12/30 (40%)
LDLa 115..146 CDD:197566 13/30 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.