DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LDLR and CG6739

DIOPT Version :9

Sequence 1:NP_000518.1 Gene:LDLR / 3949 HGNCID:6547 Length:860 Species:Homo sapiens
Sequence 2:NP_609130.1 Gene:CG6739 / 34037 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster


Alignment Length:354 Identity:78/354 - (22%)
Similarity:109/354 - (30%) Gaps:158/354 - (44%)


- Green bases have known domain annotations that are detailed below.


Human    25 DRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRC 89
            |.|..|||||.||.||...|.||...:||.|.|| .|.||                         
  Fly   430 DYCYGNEFQCHDGSCIPQNWQCDKIKDCQGGEDE-DEQCL------------------------- 468

Human    90 DGQVDCDNGSDEQGCPPKTCSQDEFRCHDG-KCISRQFVCDSDRDCLDGSDEASCPVLTCGP-AS 152
                              .|..|||||... ||:..::.||.:.||:|||||..|.....|. |.
  Fly   469 ------------------VCEPDEFRCRSNEKCLVEKYRCDQNIDCMDGSDEQDCDEYGSGDLAP 515

Human   153 FQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVF-----QGDSSPCSAFEFHCLSGEC--I 210
            |..:.....|:::...:.....:.:|:       :|.:     ..|:...:.|:.|.::...  :
  Fly   516 FDESELNAFPRVFTYASFLSPNETNDK-------VYTYITATTDEDAGTETKFQIHQVAAPAPPV 573

Human   211 HSS-WRCDGGP-------DCKD---KSDEE----------------------------------- 229
            :|| ....|||       |.|:   .||.|                                   
  Fly   574 NSSAEEGAGGPKGFVNFRDSKEIMMTSDSETKFKYSQRANRTSVKFSVSAPTTPAARTSSAIPSS 638

Human   230 ----------------------------------------NCAVAT------------CRPDEFQ 242
                                                    |.|.:.            |.|.|.:
  Fly   639 ALVQQRERTTSTTTTSTTTSTTTSSITSTPSITSTTLIPINAATSEPNPYEVVTSLGGCPPQELR 703

Human   243 CSDGNCIHGSRQCDREYDCKDMSDEVGCV 271
            |..|.||..|:.||::.||.|.:||:.||
  Fly   704 CVSGKCITVSQLCDKQIDCPDAADELMCV 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LDLRNP_000518.1 Ldl_recept_a 25..58 CDD:278486 17/32 (53%)
Ldl_recept_a 66..104 CDD:278486 0/37 (0%)
Ldl_recept_a 107..143 CDD:278486 17/36 (47%)
Ldl_recept_a 147..179 CDD:278486 4/32 (13%)
Ldl_recept_a 195..231 CDD:278486 12/123 (10%)
Ldl_recept_a 235..270 CDD:278486 15/46 (33%)
LDLa 278..308 CDD:294076
FXa_inhibition 318..>346 CDD:291342
EGF_CA 354..388 CDD:214542
LDL-receptor class B 1 397..438
LY 419..457 CDD:214531
LDL-receptor class B 2 439..485
Ldl_recept_b 439..482 CDD:278487
LDL-receptor class B 3 486..528
Ldl_recept_b 487..525 CDD:278487
LDL-receptor class B 4 529..572
Ldl_recept_b 529..569 CDD:278487
LY 553..595 CDD:214531
LDL-receptor class B 5 573..615
LDL-receptor class B 6 616..658
Ldl_recept_b 616..655 CDD:278487
FXa_inhibition 671..711 CDD:291342
Clustered O-linked oligosaccharides 721..768
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 734..755
Required for MYLIP-triggered down-regulation of LDLR. /evidence=ECO:0000269|PubMed:19520913 811..860
NPXY motif. /evidence=ECO:0000269|PubMed:22509010 823..828
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549
LDLa 432..464 CDD:238060 18/32 (56%)
LDLa 470..505 CDD:238060 17/34 (50%)
LDLa 697..731 CDD:238060 15/33 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.