DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14115 and CG34444

DIOPT Version :9

Sequence 1:NP_648629.1 Gene:CG14115 / 39487 FlyBaseID:FBgn0036343 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097313.1 Gene:CG34444 / 5740745 FlyBaseID:FBgn0085473 Length:295 Species:Drosophila melanogaster


Alignment Length:270 Identity:60/270 - (22%)
Similarity:100/270 - (37%) Gaps:97/270 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GSFGLLAAVAIPLELGPKNVYMAFNFESNYALPSNDSYNQWIDRWDLDDHYL--GVGGNVTPINA 93
            |:..|..|:|:||:|..:..::::|||.:|.||.:         |.....:|  |.|.|...:.:
  Fly    29 GASSLFVAIALPLDLRFEKAFLSYNFEVSYDLPRS---------WKQKPPFLRHGNGTNDESLLS 84

  Fly    94 RQDG---------GDFSQDEDN----------------------------------------EVR 109
            ...|         .|:..|:.|                                        :.:
  Fly    85 DHHGHHQNDDFVYDDYYDDDQNSGNKHKHKHHPHHHDKKKKKSKPKPGSVIKPQKNKPKHKHKKK 149

  Fly   110 RRSVGSPPPFRRHDFY----------------------RSIIN-----FLTHYGFN------GSA 141
            .:|...|||....|.|                      ||:::     ::.::.|.      |.:
  Fly   150 HKSKPKPPPEVDEDDYKDFFQGFPLDGMGESVGRDRQSRSLLSRTKFYYIINHRFELHGLGAGDS 214

  Fly   142 CLLRTICEVSESPLDDQNGLLGSLFQILFMPTTSAAEQELQHVDELYKASDAGTHGPGCSEYVAH 206
            ||||.|||.:...|.|.||:||||..::|.|::|..|:    :.:.|..::.......|..|...
  Fly   215 CLLRLICEANSYQLGDLNGVLGSLIHVMFSPSSSRYEE----LPKRYYIAELDGRNGNCGGYRVQ 275

  Fly   207 CGHSALDLIS 216
            |.||.||:|:
  Fly   276 CEHSVLDMIT 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14115NP_648629.1 DM4_12 116..214 CDD:214785 35/130 (27%)
CG34444NP_001097313.1 DM4_12 193..276 CDD:285126 24/86 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438018
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H117634
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105960at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.