Sequence 1: | NP_648629.1 | Gene: | CG14115 / 39487 | FlyBaseID: | FBgn0036343 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097313.1 | Gene: | CG34444 / 5740745 | FlyBaseID: | FBgn0085473 | Length: | 295 | Species: | Drosophila melanogaster |
Alignment Length: | 270 | Identity: | 60/270 - (22%) |
---|---|---|---|
Similarity: | 100/270 - (37%) | Gaps: | 97/270 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 GSFGLLAAVAIPLELGPKNVYMAFNFESNYALPSNDSYNQWIDRWDLDDHYL--GVGGNVTPINA 93
Fly 94 RQDG---------GDFSQDEDN----------------------------------------EVR 109
Fly 110 RRSVGSPPPFRRHDFY----------------------RSIIN-----FLTHYGFN------GSA 141
Fly 142 CLLRTICEVSESPLDDQNGLLGSLFQILFMPTTSAAEQELQHVDELYKASDAGTHGPGCSEYVAH 206
Fly 207 CGHSALDLIS 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14115 | NP_648629.1 | DM4_12 | 116..214 | CDD:214785 | 35/130 (27%) |
CG34444 | NP_001097313.1 | DM4_12 | 193..276 | CDD:285126 | 24/86 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45438018 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 1 | 1.000 | - | - | H117634 | |
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D105960at33392 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR21398 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.950 |