DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14115 and CG34429

DIOPT Version :9

Sequence 1:NP_648629.1 Gene:CG14115 / 39487 FlyBaseID:FBgn0036343 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097598.1 Gene:CG34429 / 5740606 FlyBaseID:FBgn0085458 Length:249 Species:Drosophila melanogaster


Alignment Length:208 Identity:52/208 - (25%)
Similarity:88/208 - (42%) Gaps:28/208 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LVFPRQG--SFGLLAAVAIPLE-LGPKNVYMAFNFESNYALPSNDSYNQWIDRWDLDDHYLGVGG 86
            |::||..  ...::|...||.| |..::|...:..::.|.||.:....:..|..::.:..|    
  Fly    44 LIYPRANPTRLQMIAGFGIPAEDLKVESVITGYVLKAQYYLPYSAKQLRTKDVHEISESRL---- 104

  Fly    87 NVTPINARQDGGDFSQDEDNEVRRRSVGSPPPFRRHDF----------YRSIINFLTHYGFNGSA 141
                   .|:...|  |:..::..:.:|..|...:.|.          |.:..........||..
  Fly   105 -------LQNATIF--DKVMQMSEQKLGFDPDILQEDLQALGSYRWSVYEAFTALAIRMKLNGRV 160

  Fly   142 CLLRTICEVSESPLDDQNGLLGSLFQILFMPTTSAAEQELQHVDELY-KASDAGTHGPGCSEYVA 205
            |:|::|||.:.:|.||:|||||.:..||..| :|:.:...:|.|..| :|...|..|..|.:...
  Fly   161 CVLKSICESAAAPFDDRNGLLGEVLHILLTP-SSSVDPLSEHSDNDYLQAERLGAAGGDCDQVYP 224

  Fly   206 HCGHSALDLISIV 218
            .|..|.|:..|.|
  Fly   225 RCPKSLLEHFSDV 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14115NP_648629.1 DM4_12 116..214 CDD:214785 32/108 (30%)
CG34429NP_001097598.1 DM4_12 137..233 CDD:214785 30/96 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452557
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D2P6
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.