DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14115 and CG34442

DIOPT Version :9

Sequence 1:NP_648629.1 Gene:CG14115 / 39487 FlyBaseID:FBgn0036343 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097311.1 Gene:CG34442 / 5740603 FlyBaseID:FBgn0085471 Length:245 Species:Drosophila melanogaster


Alignment Length:223 Identity:66/223 - (29%)
Similarity:104/223 - (46%) Gaps:34/223 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SLAHCFLVFPRQGSFGLLAAVAIPLELGPKNVYMAFNFESNYALPSN-DSYNQWIDRWDLDDHYL 82
            :|....|:|.....:|:..|:::|:.|..:||::::|:|.||..|.: ..|...:...|.:|.||
  Fly    21 NLVKSALLFTTNSEYGIFMAISVPIGLPHRNVFLSYNYEFNYYQPEHVYKYPPILMGQDFEDSYL 85

  Fly    83 --------------------GVGGNVTPINARQDGGDFSQDEDNEVRRRSVGSPPPFRRHDFYRS 127
                                .:.||   ||:.....:.::....|.|..::.|     |..||..
  Fly    86 TYPTTGREAEGRHCQNCTDWKIEGN---INSTSSNNNSTKAASREKRGLTLMS-----RSVFYAM 142

  Fly   128 IINFLTHYGFNGSACLLRTICEVSESPLDDQNGLLGSLFQILFMPTTSAAEQELQHV-DELYKAS 191
            :.:.|...||....||||.||:.:.|.|.:.||.||||..|:|.|::|..|    |: :|.|:|.
  Fly   143 LRDKLRRSGFPAEPCLLRLICDTNASQLGEVNGFLGSLVHIIFSPSSSKDE----HLPNEYYQAE 203

  Fly   192 DAGTHGPGCSEYVAHCGHSALDLISIVL 219
            ..|.....||.|...|.|:.|||:|:.|
  Fly   204 WDGREQQECSTYTKSCDHNILDLVSVSL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14115NP_648629.1 DM4_12 116..214 CDD:214785 36/98 (37%)
CG34442NP_001097311.1 DM4_12 136..219 CDD:285126 33/86 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438021
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D2P6
Homologene 1 1.000 - - H117634
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26989
OrthoDB 1 1.010 - - D105960at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.