DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14115 and CG34443

DIOPT Version :9

Sequence 1:NP_648629.1 Gene:CG14115 / 39487 FlyBaseID:FBgn0036343 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097312.1 Gene:CG34443 / 5740580 FlyBaseID:FBgn0085472 Length:239 Species:Drosophila melanogaster


Alignment Length:228 Identity:82/228 - (35%)
Similarity:122/228 - (53%) Gaps:28/228 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FYLGGVFVLG--LSLAHCFLVFPRQGSFGLLAAVAIPLELGPKNVYMAFNFESNYALPSNDSYNQ 70
            ::||.||:|.  |.|.:.|:.|....:.|:.||:|:||||..:||::::|||:||.||:|  :.:
  Fly     6 YFLGLVFLLTVYLDLTNSFVAFTASSTHGIFAAIAVPLELPHRNVFVSYNFEANYNLPAN--WEK 68

  Fly    71 W-------------IDRWDLD-DHYLGVGGNVTPINARQDGGDFSQDEDNEV--RRRSVGSPPPF 119
            |             :|..|.: |..|..|.....:....:.|....:|..||  :.|.|.|  ..
  Fly    69 WTIFQNGPIESEEVVDETDTETDRKLAAGCQNCTVKEENEAGSEEVEEITEVLPQERKVRS--LL 131

  Fly   120 RRHDFYRSIINFLTHYGFNGSACLLRTICEVSESPLDDQNGLLGSLFQILFMPTTSAAEQ-ELQH 183
            .|.:.||..::.|...||.|.:||||.|||.|.:.||:.||:||||..:||.|::|.:|. .|::
  Fly   132 TRSNIYRIFVDKLKRSGFRGESCLLRLICETSAAQLDEFNGVLGSLMHVLFSPSSSESEDLPLRY 196

  Fly   184 VDELYKASDAGTHGPGCSEYVAHCGHSALDLIS 216
                |:|...|.:| .|..|...||.|.|:|||
  Fly   197 ----YQAEHDGWNG-HCHVYEPGCGESILELIS 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14115NP_648629.1 DM4_12 116..214 CDD:214785 39/98 (40%)
CG34443NP_001097312.1 DM4_12 133..215 CDD:285126 35/86 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438020
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D2P6
Homologene 1 1.000 - - H117634
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26989
OrthoDB 1 1.010 - - D105960at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9679
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.