DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14115 and CG34184

DIOPT Version :9

Sequence 1:NP_648629.1 Gene:CG14115 / 39487 FlyBaseID:FBgn0036343 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097310.1 Gene:CG34184 / 5740423 FlyBaseID:FBgn0085213 Length:224 Species:Drosophila melanogaster


Alignment Length:213 Identity:70/213 - (32%)
Similarity:108/213 - (50%) Gaps:30/213 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LGLSLAHCFLVFPRQGSFGLLAAVAIPLELGPKNVYMAFNFESNYALPSN-DSYNQWI--DRWDL 77
            |.|......|::.....||:..|:::||.|..:||::::|:|.||..|.: ..|...:  |.|  
  Fly    12 LKLIFVESTLLYQTNSEFGIFMAISVPLTLKNRNVFLSYNYEFNYYQPEHVYKYPPILMGDNW-- 74

  Fly    78 DDHYLGVGGNVTPINARQDGGDFSQ--------DEDNEVRRRSVGSPPPFRRHDFYRSIINFLTH 134
            :|.||..  |.|       |||.|.        |:::..::|::   |...|.:||..:.:.|..
  Fly    75 EDSYLTY--NTT-------GGDDSSSSRSFRSVDDNSSTQKRTL---PIMSRTNFYIMLKDKLER 127

  Fly   135 YGFNGSACLLRTICEVSESPLDDQNGLLGSLFQILFMPTTSAAEQELQHVD-ELYKASDAGTHGP 198
            .|:...:||||.|||.:.|.|.:.||||||:..|||.|::|..|    ::| :.|:|...|....
  Fly   128 SGYPAESCLLRLICETNSSTLGEVNGLLGSIVHILFTPSSSNDE----NLDKDYYQAEWDGLRHG 188

  Fly   199 GCSEYVAHCGHSALDLIS 216
            .||.|.:.|..:.|||||
  Fly   189 DCSFYASQCEENVLDLIS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14115NP_648629.1 DM4_12 116..214 CDD:214785 36/98 (37%)
CG34184NP_001097310.1 DM4_12 114..197 CDD:285126 33/86 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438019
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D2P6
Homologene 1 1.000 - - H117634
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26989
OrthoDB 1 1.010 - - D105960at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.