DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14115 and CG5768

DIOPT Version :9

Sequence 1:NP_648629.1 Gene:CG14115 / 39487 FlyBaseID:FBgn0036343 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001369031.1 Gene:CG5768 / 42915 FlyBaseID:FBgn0039198 Length:397 Species:Drosophila melanogaster


Alignment Length:220 Identity:55/220 - (25%)
Similarity:84/220 - (38%) Gaps:56/220 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RWQFYLGGVFVLGLSLAHCFLVFPRQGSFGLLAAVAIPLELGPKNVYMAF--NFESNYALPSNDS 67
            |||        ..||....:|.||...||.:.....:.:...|...|.:|  |:...|.||:.  
  Fly   210 RWQ--------RALSRPKRYLSFPEGSSFSVAVCFTVGIIGNPYYGYNSFGLNWGVAYDLPNT-- 264

  Fly    68 YNQWIDRWDLDDHYLGVGGN-VTPINARQDGGDFSQDEDNEVRRRSVGSPPPFRRHDFYRSIINF 131
                  .|.| .|..|...: |.|.               .:||||        |...||.|...
  Fly   265 ------TWVL-QHLHGFATHPVAPA---------------VLRRRS--------RSAIYRQIEAV 299

  Fly   132 LTHYGFNGSACLLRTICEVSESPLDDQNGLLGSLFQILF-MPTTSAAEQELQ------HVDELYK 189
            :.:.|:||..|:|||:||..:.....:..::|.:.:.:| :|......:||.      |.|:.|:
  Fly   300 VDNMGYNGRDCILRTLCESRQYFQRTKMSMVGEMLRTIFSLPKQRIFTRELHENADIVHYDQAYR 364

  Fly   190 ASDAGTHGPGCSEYVAHCGHSALDL 214
                ..|...|::|  :|..|.|:|
  Fly   365 ----NAHTDDCTQY--NCHFSLLEL 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14115NP_648629.1 DM4_12 116..214 CDD:214785 27/104 (26%)
CG5768NP_001369031.1 DM4_12 286..383 CDD:214785 30/110 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452566
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.