DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14115 and CG17782

DIOPT Version :9

Sequence 1:NP_648629.1 Gene:CG14115 / 39487 FlyBaseID:FBgn0036343 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_651257.1 Gene:CG17782 / 42912 FlyBaseID:FBgn0039195 Length:479 Species:Drosophila melanogaster


Alignment Length:129 Identity:31/129 - (24%)
Similarity:52/129 - (40%) Gaps:25/129 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 PINARQDGGDFSQDEDNEVR---------RRSVGSPPPFRRHDFYRSIINFLTHYGFNGSACLLR 145
            |...::..|..::.||...|         |||        |...|..|..:|...|.:|..|:||
  Fly   351 PHKRQRRSGVATEHEDKMSRLEQLQIKHHRRS--------RQSLYERIEKYLDKRGHHGHHCVLR 407

  Fly   146 TICEVSESPLDDQNG-LLGSLFQILF-----MPTTSAAEQELQHVDELYKA-SDAGTHGPGCSE 202
            |:||..:...:.:.| .:|.|.:.:|     |.....|.:: .|.|:.:.: :|.....|.|.:
  Fly   408 TLCETGQKSTEHEPGTFVGELMRAVFTLPEAMDNEPVAYRD-SHYDKAHASKADCAVLYPECKQ 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14115NP_648629.1 DM4_12 116..214 CDD:214785 23/94 (24%)
CG17782NP_651257.1 DM4_12 378..475 CDD:214785 26/102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452601
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.