DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14115 and CG17784

DIOPT Version :9

Sequence 1:NP_648629.1 Gene:CG14115 / 39487 FlyBaseID:FBgn0036343 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_651254.1 Gene:CG17784 / 42909 FlyBaseID:FBgn0039192 Length:237 Species:Drosophila melanogaster


Alignment Length:209 Identity:45/209 - (21%)
Similarity:76/209 - (36%) Gaps:46/209 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LSLAHCFLVFPRQGSFGLLAAVAIPLELGPK--NVYMAFNFESNYALPSNDSYNQWIDRWDLDDH 80
            ||.:....::..||...|:.::|.|::...|  :.:..||.:..:...:...|  |...|     
  Fly    57 LSRSKRVAIYNGQGVVKLVPSLAYPVKQTDKEQSFWWFFNLQGQWIPTTIPLY--WWSFW----- 114

  Fly    81 YLGVGGNVTPI--NARQDGGDFSQDEDNEVRRRSVGSPPPFRRHDFYRSIINFLTHYGFN----- 138
                  |.|..  .||    ::.:|...:|            .||..|:.:......|..     
  Fly   115 ------NTTAFVSTAR----EWRKDMQAKV------------LHDEARTWVYNAIEVGMEQLDGA 157

  Fly   139 -GSACLLRTICEVSESPLDDQNGLLGSLFQILFMPTTSAAEQELQHVDELYKASDAGTHGPGCSE 202
             |..||||:|||:|:.|..:.| :...:...:.:||......:..|      |.|||..|..|..
  Fly   158 YGGVCLLRSICEISQKPFQNSN-IFSEIVNAVLVPTLDNVASKYLH------ARDAGRGGADCER 215

  Fly   203 YVAHCGHSALDLIS 216
            ..:.|......|::
  Fly   216 TYSDCNPLLWSLVT 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14115NP_648629.1 DM4_12 116..214 CDD:214785 25/103 (24%)
CG17784NP_651254.1 DM4_12 135..227 CDD:214785 25/98 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452592
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.