DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14115 and CG14720

DIOPT Version :9

Sequence 1:NP_648629.1 Gene:CG14115 / 39487 FlyBaseID:FBgn0036343 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_650108.2 Gene:CG14720 / 41415 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster


Alignment Length:208 Identity:54/208 - (25%)
Similarity:89/208 - (42%) Gaps:50/208 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LVFPRQG--SFGLLAAVAIPLE-LGPKNVYMAFNFESNYALPSNDSYNQWIDRWDLDDHYLGVGG 86
            |:||...  ....:..:.||:| |..::|...:..::.|.||:|.:        ::...||    
  Fly    30 LIFPPTSPTRVQFIGGIGIPVENLHFESVTSGYVLKAEYFLPTNST--------EITRVYL---- 82

  Fly    87 NVTPINARQDGGDFSQDEDNEVRRRSVGSP-PPFRRHDFYRSIINFLTHYGFNGSACLLRTICEV 150
                             :...:..|...|| ....|...||.|...:.:.|..|.:||||.|||.
  Fly    83 -----------------KPMAITGREKESPYGALYRWIIYRGIEMVIENMGLPGRSCLLRLICEH 130

  Fly   151 SESPLDDQNGLLGSLFQILFMPTTSAAEQELQHVDELYKASDA--------GTHGPGC-SEYVAH 206
            :..||:.::||||.:..|:..|::|        ||:|.::||.        |..|..| :.|.:.
  Fly   131 AALPLNHESGLLGEIMNIVLRPSSS--------VDQLGQSSDREYHTSEHFGKRGGDCQAAYASR 187

  Fly   207 CGHSALDLISIVL 219
            |..|.::|||::|
  Fly   188 CKKSPMELISLLL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14115NP_648629.1 DM4_12 116..214 CDD:214785 34/107 (32%)
CG14720NP_650108.2 DM4_12 96..195 CDD:214785 33/106 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452556
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.