DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14115 and CG14829

DIOPT Version :9

Sequence 1:NP_648629.1 Gene:CG14115 / 39487 FlyBaseID:FBgn0036343 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_648089.2 Gene:CG14829 / 38792 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster


Alignment Length:206 Identity:49/206 - (23%)
Similarity:76/206 - (36%) Gaps:48/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LVFPRQGSFGLLAAVAIPLELGPKNV------YMAFNFESNYALPSNDSYNQWIDRWDLDDHYLG 83
            |::...|:..|:....:..:|....|      |...:|.: :.|||...| .| |:|:       
  Fly    45 LIYRNGGTIRLVVGPVLSTQLEDPVVWRSLVYYYVLHFGA-FTLPSAPLY-PW-DKWE------- 99

  Fly    84 VGGNVTPINARQDGGDF-SQDEDNEVRRRSVGSPPPFRRHDFYRSIINFLTHYGFN---GSACLL 144
                  .|.||...... |.||.:|...|..          .|.::.|::.....:   |..|||
  Fly   100 ------TIYARSLQEKIRSLDETHEDDTRLF----------VYAALENYMDQVSGSPGRGRHCLL 148

  Fly   145 RTICEVSESPLDDQNGLLGSLFQILFMPTTSAAEQELQHVDELYK-ASDAGTHGPGCSEYVAHC- 207
            |.|||  .:.:....|::..|..:|..|..:       .:|..|| |..||..|..|....:.| 
  Fly   149 RGICE--NAQVHHHVGIMAELLVVLLTPGKT-------RLDVAYKEALAAGQAGIDCLARYSDCP 204

  Fly   208 -GHSALDLISI 217
             |.|.||..::
  Fly   205 RGESVLDAYAL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14115NP_648629.1 DM4_12 116..214 CDD:214785 26/103 (25%)
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 27/111 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452589
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.